Serpentinimonas maccroryi: SMCB_0285 Help Entry SMCB_0285         CDS       T03627                                  Name (GenBank) exonuclease VII small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism cbab  Serpentinimonas maccroryi Pathway cbab03430   Mismatch repair Brite KEGG Orthology (KO) [BR:cbab00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     SMCB_0285  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cbab03400]     SMCB_0285 Enzymes [BR:cbab01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      SMCB_0285 DNA repair and recombination proteins [BR:cbab03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      SMCB_0285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S BMFP Nuf2_DHR10-like Motif Other DBs NCBI-ProteinID:  BAO82513 UniProt:  A0A060NSJ5 LinkDB All DBs Position 318014..318259 Genome browser AA seq 81 aa AA seqDB search MPKPKAGQAAADVPPSYEAAAQELDALLARLDGGQLPLDELLTQHQRGNELLAYCRARLE ALEQQLTVLENGAERPWTPQP NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcccaaacccaaagctggccaagccgctgccgatgtccccccatcgtacgaagccgcg gcgcaagagctcgacgccctgctggcccggctcgatggcggccagttgccgctcgacgag ttgctcacgcagcaccagcgcggcaacgagctgctggcctactgccgcgcccggctcgag gcgctggagcagcagctcacggtgctcgaaaacggcgccgagcgcccctggacgccccag ccgtga

DBGET integrated database retrieval system