KEGG   Serpentinimonas maccroryi: SMCB_0842
Entry
SMCB_0842         CDS       T03627                                 
Name
(GenBank) Rad3-related DNA helicase
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
cbab  Serpentinimonas maccroryi
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cbab03400]
    SMCB_0842
Enzymes [BR:cbab01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     SMCB_0842
DNA repair and recombination proteins [BR:cbab03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    SMCB_0842
SSDB
Motif
Pfam: Helicase_C_2 DEAD DEAD_2 ResIII AAA_22 ATG16
Other DBs
NCBI-ProteinID: BAO83070
UniProt: A0A060NNX1
LinkDB
Position
880922..883237
AA seq 771 aa
MRLCHTLLLMDKPELAQQALACYDRLLQRDQRLRPRPGQRLMAEQVAQTFSQADLGPLEA
SQALPGVEPQRALAVIQAGTGVGKSLAYCAPALALALERNTRVLISTATVALQEQLVHKD
LPALVAQFEQPIRYALAKGRGRYVCKLKLERRLAGLGAARGNDAAADEDLHEDDWFLEAQ
PPQPGGSSDVDTLLALQADLASGRWSGDFDDLSQPPAGLLWQSVAVQASSCAARHCPVYG
QCSYFEQRKELVGAQVIVVNHDLLLSTLGSRTLPDLDNCLLVIDEAHHLPAVALEQFASR
MDLSRLGWIERLAQRAMRAGATLGLAELAGVHEQAAALRQAMQELARWVVQQHGPELSAA
PRESAGFGLLGAHAATRPAAAAALGAVPAGFTPERVARLSQGQTPAALLQTLEALQRSSG
AFIDSLRLLAKALRAEMRDQPQQSRQLATLYAQLGSLTPRLEAAHETARLFLQQPSLGDE
PVAKWFSVQSAGADAALMAHASPTLPGSTLRQHLWGSVRAAVLTSATLSSGGRFDYFLRE
SGLEHDPDACTLEVPSPFDFSRQGRLVLGGTRADPKEASAFNAELVCSLLQDLAAVRHGA
LVLFTSRLQMRLACEALPTALRARVLVQNELPRQRLLRLHAERVAAGQPSIIFGMQSFGE
GLDLPGRLCEDLFITKLPFAPPDDPVGQARAEWLRAAGRDPFQELVLPAAAIRLAQWVGR
AIRTEDDQAHVVCYDRRLHQSSYGRQLLAGLPGFERIVRAPLQPLPEPAER
NT seq 2316 nt   +upstreamnt  +downstreamnt
ttgcgcttgtgccacactctgctgcttatggataaacccgaactggcgcagcaggcgctg
gcctgctacgaccggctgttgcagcgcgaccagcggctgcggccgcggccggggcagcgc
ctgatggccgaacaagtggcgcagaccttcagtcaagccgatctggggccgttggaggcc
tcgcaggctttgcccggggtggagccgcagcgggccttggccgtcatccaagccggcacc
ggggtgggcaaatcgctcgcctactgcgcgccggcgctggcgctggcgctcgagcgcaac
acgcgcgtgctcatcagcaccgccaccgtggccttgcaagagcaactggtgcacaaagac
ttgccggccctggtggcgcagttcgaacagcccatacgctacgccttggccaagggccgc
ggccgctacgtgtgcaagctcaagctggagcgccgcttggctggcttgggggctgcgcgg
ggcaatgacgccgccgccgacgaggatttgcacgaggacgattggtttctcgaggcgcag
ccaccccagcccgggggcagcagcgacgtggacaccttgctggccctgcaagccgatttg
gccagcggtcgctggagcggcgacttcgatgacttgagccagccccctgcaggcctgctg
tggcagtcggtggcggtgcaagccagttcgtgtgcggcgcgccattgtccggtctatggc
cagtgcagctatttcgagcagcgcaaggagttggtgggggcgcaggtgatcgtggtcaac
cacgacttgttgctcagcaccttgggctcgcgcaccttgcccgatctggacaactgcctg
ctggtgatcgacgaggcgcaccacctgccggcggtggccttggagcagtttgccagccgc
atggacttgagccgcttgggctggatcgagcgcttggcgcagcgcgccatgcgcgccggc
gccacattggggctggcagaactggccggcgtgcacgaacaagcggcggcgctgcgccaa
gccatgcaagagctggcgcgctgggtggtgcagcagcatggccccgagttgagcgcggcg
ccgcgggagtctgctggctttggcctgctgggcgcccatgcagcgactcgccctgccgct
gcggcggctttgggggcggtgccggctggctttacacccgagcgcgtggcccggctcagc
caaggccaaacccccgctgcgttgctgcagaccttggaggcgctgcagcgcagttcgggg
gctttcatcgactcgttgcggctgctggccaaggcgttgcgcgccgaaatgcgcgatcag
ccgcagcagtcgcgtcagctggcgactctgtacgcccagttgggcagcctgacgccgcgc
ctcgaggccgcgcacgagactgcgcgcttgtttttgcagcagcccagcctaggggacgaa
ccggtcgccaaatggttcagcgtgcagtctgcgggggccgatgcggcgctgatggcgcac
gccagcccgaccctgcccggcagcaccttgcgccagcacctgtggggctcggtgcgcgcc
gccgtgctgacgtcggcgaccttgagcagcggcgggcgttttgattattttttgcgcgag
tctgggctggagcacgacccagacgcttgcacgctcgaagtgcccagccccttcgacttc
agccgccaggggcgactggtgctgggcggcacccgcgccgaccccaaagaggccagcgcc
ttcaacgccgagctggtgtgcagcctgttgcaagatctggccgcagtgcgccacggggcg
ctggtgctgtttacctcgcgcctgcagatgcggctggcttgcgaggccctgccgacggcc
ctgcgcgcgcgggtgctggtgcaaaacgagctgccacgccagcgcctgctgcgcttgcac
gccgagcgcgtggcggctgggcagccgtcgatcatttttggcatgcagtcttttggcgag
ggcctggatttgccgggccggctgtgcgaggacttgttcatcaccaaactgccctttgcc
ccgcccgacgacccggtgggccaagcgcgggccgagtggctgcgcgctgctgggcgcgac
ccgtttcaagagctggtgctgcccgcggcggcgatccgactggcgcagtgggtggggcgt
gccatccgcaccgaagacgaccaagcgcacgtggtgtgctacgaccggcgcttgcaccaa
agcagctacgggcgccagctgctggcgggcctgccgggctttgagcgcatcgtgcgcgcg
ccgcttcagccgctgccagagccggccgagcgctaa

DBGET integrated database retrieval system