Serpentinimonas maccroryi: SMCB_1686 Help Entry SMCB_1686         CDS       T03627                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cbab  Serpentinimonas maccroryi Pathway cbab01100   Metabolic pathways cbab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMCB_1686 (acpP)    00074 Mycolic acid biosynthesis     SMCB_1686 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMCB_1686 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  BAO83914 UniProt:  A0A060NYG3 LinkDB All DBs Position complement(1814342..1814581) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQHAVDYALAHQKG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgaagcacgtgtgaagaaaatcatcgccgaacaactcggcgtagaagag tcccaggtcaccaacgaaaaagccttcgtggccgatctgggtgccgactcgctcgacacc gtggaactggtcatggccctggaagacgagttcgggatcgagatcccggacgaagacgcc gaaaaaatcaccaccgttcagcacgccgtcgattacgcgctggcgcatcagaaaggctga

DBGET integrated database retrieval system