KEGG   Clostridiales bacterium FE2010: JS518_04560
Entry
JS518_04560       CDS       T08976                                 
Name
(GenBank) rod shape-determining protein RodA
  KO
K05837  peptidoglycan glycosyltransferase [EC:2.4.99.28]
Organism
cbaf  Clostridiales bacterium FE2010
Pathway
cbaf00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cbaf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JS518_04560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cbaf01003]
    JS518_04560
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbaf01011]
    JS518_04560
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cbaf03036]
    JS518_04560
Enzymes [BR:cbaf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.28  peptidoglycan glycosyltransferase
     JS518_04560
Glycosyltransferases [BR:cbaf01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   JS518_04560
Peptidoglycan biosynthesis and degradation proteins [BR:cbaf01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   JS518_04560
Chromosome and associated proteins [BR:cbaf03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    JS518_04560
SSDB
Motif
Pfam: FTSW_RODA_SPOVE
Other DBs
NCBI-ProteinID: QTE75160
LinkDB
Position
complement(1020565..1021788)
AA seq 407 aa
MTITENRHARAHVDGVLIALVFAMALFGIVAVCVATYSPNSAEDASFLNHVIESSYAMKQ
CLFVLMAPLVIGVIMAFPYDILRRRAEWFYWAAFILLSVTTIFNRAQGVKAWLDTLWGYT
IQPSEFMKLAMILVLAKNFSRQDSPMSDSKSFIHIFMIVIIPGVVILLQGETGSLLVIIF
MFAVMMYFANVSLKTLSILAALAILGVLAIYGYMTLTHSTDYRLARIAGWLNPEVYSSSD
AYQQTMSKMTIGSGGLTGNGMFVTGAISQLNYVPADWTDFIYSTIGETWGFVGCVAVLVG
YVLILLRMLYLAWFTRDKFGRMIIIGVLGMLLFHVLENIAMTLGLMPITGIPLPFLSYGG
SNMMTNMGGVGLVLNATRNRSLNVSVSTPQTFYNPYRIHKRFKTKSY
NT seq 1224 nt   +upstreamnt  +downstreamnt
ttgacgatcactgaaaaccgtcatgcccgtgcacatgtggacggtgttctgatcgcgctt
gtttttgccatggctcttttcggaatcgttgctgtctgtgttgctacctattctcccaat
tccgctgaagacgcatcgttcctgaatcatgttattgagtcttcctacgcgatgaagcag
tgccttttcgtcctgatggctccccttgtcatcggcgtaattatggccttcccttacgat
atcctcagacgccgtgcggaatggttctactgggcggcttttatcctgctgtctgtcact
acgatttttaaccgggcccagggcgttaaagcctggcttgataccttgtggggctacacc
attcagccttcggaattcatgaagctggctatgatcctggtgcttgccaaaaacttctcc
aggcaggacagtcccatgtccgattccaagtcctttattcatatcttcatgatcgtcatc
attcccggcgttgtgatcctgcttcagggtgaaacaggctccctgctcgttattatcttc
atgtttgccgtgatgatgtatttcgcgaatgtttccctgaagacgctttcgattctcgct
gcccttgccatcctgggggttctggcgatctacggatatatgacccttacccattcaaca
gactatcgtcttgcccggattgccggctggctgaatcctgaagtgtattcttcttccgat
gcttaccagcaaaccatgtccaaaatgaccatcggatccggcgggctgacaggaaacggc
atgttcgttaccggcgccatttcccagctgaactacgtgccggcggactggacggatttc
atttattccaccatcggtgaaacctggggctttgtaggctgtgtggcggttcttgtcgga
tatgtgctgatcctgctccgtatgctttacctggcctggtttacccgggataaattcggc
cggatgatcattatcggtgttctgggcatgcttcttttccatgtgctcgaaaatattgcc
atgaccctgggtctcatgccgattaccggtattccgctgcctttcctgtcctatggcgga
tccaatatgatgacaaatatgggcggtgtaggcctggtgctgaatgcgacccggaatcgt
tccctgaacgtttctgtcagcactccccagacattctataatccttatcgtatccacaaa
cgctttaagacaaaatcctactga

DBGET integrated database retrieval system