Camelus bactrianus (Bactrian camel): 105062037 Help Entry 105062037         CDS       T07534                                  Symbol PFN3 Name (RefSeq) LOW QUALITY PROTEIN: profilin-3   KO K05759   profilin Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04015   Rap1 signaling pathway cbai04810   Regulation of actin cytoskeleton cbai05014   Amyotrophic lateral sclerosis cbai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105062037 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105062037 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105062037 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105062037 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbai04131]     105062037 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cbai04812]     105062037 (PFN3)    04147 Exosome [BR:cbai04147]     105062037 (PFN3) Membrane trafficking [BR:cbai04131]  Others   Actin-binding proteins    Others     105062037 (PFN3) Cytoskeleton proteins [BR:cbai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105062037 (PFN3) Exosome [BR:cbai04147]  Exosomal proteins   Proteins found in most exosomes    105062037 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105062037 NCBI-ProteinID:  XP_010944497 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSGLDGRAVCVGHTPRALLVLMGRRGVHGGVLNKTMHELIHGLRMQGS NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaagtctacatcagcgcggtgctgcgggaccagcgcatcgacgacgtg gctatcgtgggccactcggacaatcgctgcgtgtgggcatcgcggcccgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcacggggccggatcggcgcaccttcctg caggccggcctgagcgggctggacgggcgcgccgtctgcgttggccacacgccgcgtgcg ctcctcgtgctcatgggccgacggggcgttcacgggggcgttctcaacaagacgatgcac gagctgatccacgggttgcgaatgcagggcagctag

DBGET integrated database retrieval system