Camelus bactrianus (Bactrian camel): 105062641 Help Entry 105062641         CDS       T07534                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04010   MAPK signaling pathway cbai04014   Ras signaling pathway cbai04015   Rap1 signaling pathway cbai04024   cAMP signaling pathway cbai04072   Phospholipase D signaling pathway cbai04137   Mitophagy - animal cbai04140   Autophagy - animal cbai04218   Cellular senescence cbai04360   Axon guidance cbai04371   Apelin signaling pathway cbai04625   C-type lectin receptor signaling pathway cbai04810   Regulation of actin cytoskeleton cbai05132   Salmonella infection cbai05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105062641 (RRAS)    04014 Ras signaling pathway     105062641 (RRAS)    04015 Rap1 signaling pathway     105062641 (RRAS)    04371 Apelin signaling pathway     105062641 (RRAS)    04072 Phospholipase D signaling pathway     105062641 (RRAS)    04024 cAMP signaling pathway     105062641 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105062641 (RRAS)    04137 Mitophagy - animal     105062641 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     105062641 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105062641 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105062641 (RRAS)   09158 Development and regeneration    04360 Axon guidance     105062641 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105062641 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105062641 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:cbai04031]     105062641 (RRAS) GTP-binding proteins [BR:cbai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105062641 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  105062641 NCBI-ProteinID:  XP_010945289 UniProt:  A0A9W3EE43 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVS KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacggggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgatccc actattgaagactcctacacgaagatctgcacagtggatggcgtcccggcccggcttgac atcctggacaccgcaggccaggaggagtttggtgccatgagggagcagtacatgcgcgcg ggccacggcttcctgctggtgtttgccattaatgaccggcagagtttcaacgaggtgagc aagctcttcacacagatcctcagagtcaaggaccgagatgacttccccatcgtgttagtc gggaacaaggcagatctggagacacaacgccaggttccccgatcggaagcctccgccttc agcgcctcccaccatgtggcctactttgaggcgtcggccaaactgcgcctcaacgtggat gaggccttcgagcagctggtgcgggcagtccggaagtaccaggaacaagagctcccgccc agtccccccagcgcccccaggaagaaggatgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system