Camelus bactrianus (Bactrian camel): 105063880 Help Entry 105063880         CDS       T07534                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04015   Rap1 signaling pathway cbai04810   Regulation of actin cytoskeleton cbai05014   Amyotrophic lateral sclerosis cbai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105063880 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105063880 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105063880 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105063880 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbai04131]     105063880 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cbai04812]     105063880 (PFN4)    04147 Exosome [BR:cbai04147]     105063880 (PFN4) Membrane trafficking [BR:cbai04131]  Others   Actin-binding proteins    Others     105063880 (PFN4) Cytoskeleton proteins [BR:cbai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105063880 (PFN4) Exosome [BR:cbai04147]  Exosomal proteins   Proteins found in most exosomes    105063880 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105063880 NCBI-ProteinID:  XP_010946880 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPRDVRTLVNGFAKNPLIAR REGLYFKEKDYKCIRADEYSLYAKNENTGVVVVKTQLYLLVATYTEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctactgggaacgaaacatgtggacagt gcagccctcatcaaactccaggagcggagcctttgtgtagcatcaccaggattcagtgta atgccccgtgatgtccgaacacttgttaatggattcgccaagaaccctttgatagccaga agagaaggattgtatttcaaggagaaggactacaaatgtatccgggcagatgagtattct ctttatgctaagaatgaaaatactggtgtcgttgttgtgaagacccagctgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagaagctg ggagactatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system