Camelus bactrianus (Bactrian camel): 105066234 Help Entry 105066234         CDS       T07534                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai03410   Base excision repair cbai04140   Autophagy - animal cbai04217   Necroptosis cbai04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:cbai00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     105066234 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105066234 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     105066234 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105066234 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbai03036]     105066234 (HMGB1)    03400 DNA repair and recombination proteins [BR:cbai03400]     105066234 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbai04147]     105066234 (HMGB1) Chromosome and associated proteins [BR:cbai03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     105066234 (HMGB1) DNA repair and recombination proteins [BR:cbai03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      105066234 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      105066234 (HMGB1) Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105066234 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  105066234 NCBI-ProteinID:  XP_010949837 UniProt:  A0A9W3EKC4 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccagatgcttcagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattc gaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacttatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttttgttctgaatatcgtccaaaaatcaaaggagaacatcctggccta tccattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcagatgac aagcagccttatgaaaagaaggctgctaaactgaaggaaaagtacgaaaaggatattgct gcatatcgagctaaagggaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaagaagatgaagaggatgaggaggaggag gaagatgaagaagacgaagaggaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system