KEGG   Camelus bactrianus (Bactrian camel): 105069943
Entry
105069943         CDS       T07534                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
cbai  Camelus bactrianus (Bactrian camel)
Pathway
cbai01521  EGFR tyrosine kinase inhibitor resistance
cbai01522  Endocrine resistance
cbai04010  MAPK signaling pathway
cbai04012  ErbB signaling pathway
cbai04014  Ras signaling pathway
cbai04015  Rap1 signaling pathway
cbai04062  Chemokine signaling pathway
cbai04068  FoxO signaling pathway
cbai04071  Sphingolipid signaling pathway
cbai04072  Phospholipase D signaling pathway
cbai04137  Mitophagy - animal
cbai04140  Autophagy - animal
cbai04144  Endocytosis
cbai04150  mTOR signaling pathway
cbai04151  PI3K-Akt signaling pathway
cbai04210  Apoptosis
cbai04211  Longevity regulating pathway
cbai04213  Longevity regulating pathway - multiple species
cbai04218  Cellular senescence
cbai04360  Axon guidance
cbai04370  VEGF signaling pathway
cbai04371  Apelin signaling pathway
cbai04510  Focal adhesion
cbai04519  Cadherin signaling
cbai04540  Gap junction
cbai04550  Signaling pathways regulating pluripotency of stem cells
cbai04625  C-type lectin receptor signaling pathway
cbai04630  JAK-STAT signaling pathway
cbai04650  Natural killer cell mediated cytotoxicity
cbai04660  T cell receptor signaling pathway
cbai04662  B cell receptor signaling pathway
cbai04664  Fc epsilon RI signaling pathway
cbai04714  Thermogenesis
cbai04720  Long-term potentiation
cbai04722  Neurotrophin signaling pathway
cbai04725  Cholinergic synapse
cbai04726  Serotonergic synapse
cbai04730  Long-term depression
cbai04810  Regulation of actin cytoskeleton
cbai04910  Insulin signaling pathway
cbai04912  GnRH signaling pathway
cbai04915  Estrogen signaling pathway
cbai04916  Melanogenesis
cbai04917  Prolactin signaling pathway
cbai04919  Thyroid hormone signaling pathway
cbai04921  Oxytocin signaling pathway
cbai04926  Relaxin signaling pathway
cbai04929  GnRH secretion
cbai04933  AGE-RAGE signaling pathway in diabetic complications
cbai04935  Growth hormone synthesis, secretion and action
cbai05010  Alzheimer disease
cbai05022  Pathways of neurodegeneration - multiple diseases
cbai05034  Alcoholism
cbai05132  Salmonella infection
cbai05160  Hepatitis C
cbai05161  Hepatitis B
cbai05163  Human cytomegalovirus infection
cbai05165  Human papillomavirus infection
cbai05166  Human T-cell leukemia virus 1 infection
cbai05167  Kaposi sarcoma-associated herpesvirus infection
cbai05170  Human immunodeficiency virus 1 infection
cbai05200  Pathways in cancer
cbai05203  Viral carcinogenesis
cbai05205  Proteoglycans in cancer
cbai05206  MicroRNAs in cancer
cbai05207  Chemical carcinogenesis - receptor activation
cbai05208  Chemical carcinogenesis - reactive oxygen species
cbai05210  Colorectal cancer
cbai05211  Renal cell carcinoma
cbai05213  Endometrial cancer
cbai05214  Glioma
cbai05215  Prostate cancer
cbai05216  Thyroid cancer
cbai05218  Melanoma
cbai05219  Bladder cancer
cbai05220  Chronic myeloid leukemia
cbai05221  Acute myeloid leukemia
cbai05223  Non-small cell lung cancer
cbai05224  Breast cancer
cbai05225  Hepatocellular carcinoma
cbai05226  Gastric cancer
cbai05230  Central carbon metabolism in cancer
cbai05231  Choline metabolism in cancer
cbai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cbai05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cbai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105069943 (HRAS)
   04012 ErbB signaling pathway
    105069943 (HRAS)
   04014 Ras signaling pathway
    105069943 (HRAS)
   04015 Rap1 signaling pathway
    105069943 (HRAS)
   04370 VEGF signaling pathway
    105069943 (HRAS)
   04371 Apelin signaling pathway
    105069943 (HRAS)
   04630 JAK-STAT signaling pathway
    105069943 (HRAS)
   04068 FoxO signaling pathway
    105069943 (HRAS)
   04072 Phospholipase D signaling pathway
    105069943 (HRAS)
   04071 Sphingolipid signaling pathway
    105069943 (HRAS)
   04151 PI3K-Akt signaling pathway
    105069943 (HRAS)
   04150 mTOR signaling pathway
    105069943 (HRAS)
  09133 Signaling molecules and interaction
   04519 Cadherin signaling
    105069943 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105069943 (HRAS)
   04140 Autophagy - animal
    105069943 (HRAS)
   04137 Mitophagy - animal
    105069943 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105069943 (HRAS)
   04218 Cellular senescence
    105069943 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105069943 (HRAS)
   04540 Gap junction
    105069943 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105069943 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105069943 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105069943 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    105069943 (HRAS)
   04660 T cell receptor signaling pathway
    105069943 (HRAS)
   04662 B cell receptor signaling pathway
    105069943 (HRAS)
   04664 Fc epsilon RI signaling pathway
    105069943 (HRAS)
   04062 Chemokine signaling pathway
    105069943 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105069943 (HRAS)
   04929 GnRH secretion
    105069943 (HRAS)
   04912 GnRH signaling pathway
    105069943 (HRAS)
   04915 Estrogen signaling pathway
    105069943 (HRAS)
   04917 Prolactin signaling pathway
    105069943 (HRAS)
   04921 Oxytocin signaling pathway
    105069943 (HRAS)
   04926 Relaxin signaling pathway
    105069943 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    105069943 (HRAS)
   04919 Thyroid hormone signaling pathway
    105069943 (HRAS)
   04916 Melanogenesis
    105069943 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105069943 (HRAS)
   04726 Serotonergic synapse
    105069943 (HRAS)
   04720 Long-term potentiation
    105069943 (HRAS)
   04730 Long-term depression
    105069943 (HRAS)
   04722 Neurotrophin signaling pathway
    105069943 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105069943 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105069943 (HRAS)
   04213 Longevity regulating pathway - multiple species
    105069943 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105069943 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105069943 (HRAS)
   05206 MicroRNAs in cancer
    105069943 (HRAS)
   05205 Proteoglycans in cancer
    105069943 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    105069943 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105069943 (HRAS)
   05203 Viral carcinogenesis
    105069943 (HRAS)
   05230 Central carbon metabolism in cancer
    105069943 (HRAS)
   05231 Choline metabolism in cancer
    105069943 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105069943 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105069943 (HRAS)
   05225 Hepatocellular carcinoma
    105069943 (HRAS)
   05226 Gastric cancer
    105069943 (HRAS)
   05214 Glioma
    105069943 (HRAS)
   05216 Thyroid cancer
    105069943 (HRAS)
   05221 Acute myeloid leukemia
    105069943 (HRAS)
   05220 Chronic myeloid leukemia
    105069943 (HRAS)
   05218 Melanoma
    105069943 (HRAS)
   05211 Renal cell carcinoma
    105069943 (HRAS)
   05219 Bladder cancer
    105069943 (HRAS)
   05215 Prostate cancer
    105069943 (HRAS)
   05213 Endometrial cancer
    105069943 (HRAS)
   05224 Breast cancer
    105069943 (HRAS)
   05223 Non-small cell lung cancer
    105069943 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105069943 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    105069943 (HRAS)
   05161 Hepatitis B
    105069943 (HRAS)
   05160 Hepatitis C
    105069943 (HRAS)
   05163 Human cytomegalovirus infection
    105069943 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105069943 (HRAS)
   05165 Human papillomavirus infection
    105069943 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105069943 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105069943 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105069943 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    105069943 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105069943 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105069943 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105069943 (HRAS)
   01522 Endocrine resistance
    105069943 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cbai04131]
    105069943 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbai04147]
    105069943 (HRAS)
   04031 GTP-binding proteins [BR:cbai04031]
    105069943 (HRAS)
Membrane trafficking [BR:cbai04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    105069943 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105069943 (HRAS)
Exosome [BR:cbai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105069943 (HRAS)
  Exosomal proteins of colorectal cancer cells
   105069943 (HRAS)
GTP-binding proteins [BR:cbai04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105069943 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Ldh_1_N DUF6974 CdhD
Other DBs
NCBI-GeneID: 105069943
NCBI-ProteinID: XP_010954497
UniProt: A0A9W3G6W2 A0AC58QYP2 A0AC58QYP1 A0AC58QYR6 A0AC58QYP3 A0AC58QYP7
LinkDB
Position
Unknown
AA seq 197 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVEARQAQDLARSYGIPYIETSAKTRQGRLWFRLQLRDPLGPSGTPGTQQPLALGWR
TPSTRWCERSGSTRCAS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacggaatataagctcgtagtggtgggcgccggaggcgtggggaagagcgcgctgacc
atccagctcattcagaaccacttcgtggacgagtacgaccccaccatagaggactcctac
cggaagcaagtagtcattgatggggagacatgcctgctggacatcctggacacagcaggc
caggaggagtacagcgctatgcgggaccaatacatgcgcaccggggagggcttcctctgt
gtgttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcccgcaccgtggaggctcggcaagcccaggacctcgcccgcagctacggcatcccc
tacattgagacttcagccaagactcgacagggcagactctggttcaggctccagctccgg
gaccccctgggaccctccgggacccccgggacccagcagcccctggcgctggggtggagg
acgccttctacacgctggtgcgagagatccggcagcacaaggtgcgcaagctga

DBGET integrated database retrieval system