Camelus bactrianus (Bactrian camel): 105069975 Help Entry 105069975         CDS       T07534                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04613   Neutrophil extracellular trap formation cbai05034   Alcoholism cbai05202   Transcriptional misregulation in cancer cbai05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cbai00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105069975  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105069975   09163 Immune disease    05322 Systemic lupus erythematosus     105069975   09165 Substance dependence    05034 Alcoholism     105069975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbai03036]     105069975   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbai04147]     105069975 Chromosome and associated proteins [BR:cbai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105069975 Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105069975 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF TMA7 Motif Other DBs NCBI-GeneID:  105069975 NCBI-ProteinID:  XP_010954528 UniProt:  A0A9W3ERI7 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MEVFAAAAAPLSLSNASAASRLPSSNRRRRRTAGKAPRKNLATKASRKSAPSTGGVKKPH RYRPGTVALREIRRYQKSTELLIRKLPFQRLVRGIAQDFKTDLRFQSAALGALQAASKAC LAFLKTPTCVLSMPKV NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggaggtgttcgcagccgccgccgcgccgctgtcgctctccaacgccagcgctgcctct agattgccgagctccaaccgaaggagaaggaggaccgccggcaaagcaccgaggaagaac ctggctacaaaagcctctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtaccgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcggggaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctcttggtgctttgcaggcggcaagtaaggcctgt ctggcctttttgaagacaccaacctgtgtgctatccatgccaaaagtgtaa

DBGET integrated database retrieval system