Camelus bactrianus (Bactrian camel): 105070329 Help Entry 105070329         CDS       T07534                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai03030   DNA replication cbai03410   Base excision repair cbai03420   Nucleotide excision repair cbai03430   Mismatch repair cbai03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cbai00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105070329 (POLD4)    03410 Base excision repair     105070329 (POLD4)    03420 Nucleotide excision repair     105070329 (POLD4)    03430 Mismatch repair     105070329 (POLD4)    03440 Homologous recombination     105070329 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cbai03032]     105070329 (POLD4)    03400 DNA repair and recombination proteins [BR:cbai03400]     105070329 (POLD4) DNA replication proteins [BR:cbai03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     105070329 (POLD4) DNA repair and recombination proteins [BR:cbai03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       105070329 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      105070329 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  105070329 NCBI-ProteinID:  XP_010955019 UniProt:  A0A9W3ESB4 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRRESPAGHSKRELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPPEVRQVLCAHPGDPRFQCSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagagcccc gctgggcacagcaagcgggagctggcaccagagctaggggaagagccccagcccctgagc gtggatgaagcagagctggagctactgaggcagtttgacctggcctggcagtatgggccc tgcacagggatcacacggctgcagcgctggcatcgggcagagcagatgggcttggagcct cccccggaagtccgtcaggtgctgtgtgcccaccctggagatccccgcttccagtgcagc ctctggcatctctatcccctttga

DBGET integrated database retrieval system