Camelus bactrianus (Bactrian camel): 105071674 Help Entry 105071674         CDS       T07534                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai01522   Endocrine resistance cbai04010   MAPK signaling pathway cbai04012   ErbB signaling pathway cbai04024   cAMP signaling pathway cbai04137   Mitophagy - animal cbai04210   Apoptosis cbai04310   Wnt signaling pathway cbai04380   Osteoclast differentiation cbai04510   Focal adhesion cbai04530   Tight junction cbai04620   Toll-like receptor signaling pathway cbai04621   NOD-like receptor signaling pathway cbai04625   C-type lectin receptor signaling pathway cbai04657   IL-17 signaling pathway cbai04658   Th1 and Th2 cell differentiation cbai04659   Th17 cell differentiation cbai04660   T cell receptor signaling pathway cbai04662   B cell receptor signaling pathway cbai04668   TNF signaling pathway cbai04722   Neurotrophin signaling pathway cbai04912   GnRH signaling pathway cbai04915   Estrogen signaling pathway cbai04921   Oxytocin signaling pathway cbai04926   Relaxin signaling pathway cbai04932   Non-alcoholic fatty liver disease cbai04933   AGE-RAGE signaling pathway in diabetic complications cbai05030   Cocaine addiction cbai05031   Amphetamine addiction cbai05132   Salmonella infection cbai05133   Pertussis cbai05135   Yersinia infection cbai05140   Leishmaniasis cbai05142   Chagas disease cbai05161   Hepatitis B cbai05162   Measles cbai05166   Human T-cell leukemia virus 1 infection cbai05167   Kaposi sarcoma-associated herpesvirus infection cbai05169   Epstein-Barr virus infection cbai05170   Human immunodeficiency virus 1 infection cbai05171   Coronavirus disease - COVID-19 cbai05200   Pathways in cancer cbai05203   Viral carcinogenesis cbai05207   Chemical carcinogenesis - receptor activation cbai05208   Chemical carcinogenesis - reactive oxygen species cbai05210   Colorectal cancer cbai05211   Renal cell carcinoma cbai05224   Breast cancer cbai05231   Choline metabolism in cancer cbai05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cbai05321   Inflammatory bowel disease cbai05323   Rheumatoid arthritis cbai05417   Lipid and atherosclerosis cbai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105071674 (JUN)    04012 ErbB signaling pathway     105071674 (JUN)    04310 Wnt signaling pathway     105071674 (JUN)    04668 TNF signaling pathway     105071674 (JUN)    04024 cAMP signaling pathway     105071674 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     105071674 (JUN)   09143 Cell growth and death    04210 Apoptosis     105071674 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105071674 (JUN)    04530 Tight junction     105071674 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105071674 (JUN)    04621 NOD-like receptor signaling pathway     105071674 (JUN)    04625 C-type lectin receptor signaling pathway     105071674 (JUN)    04660 T cell receptor signaling pathway     105071674 (JUN)    04658 Th1 and Th2 cell differentiation     105071674 (JUN)    04659 Th17 cell differentiation     105071674 (JUN)    04657 IL-17 signaling pathway     105071674 (JUN)    04662 B cell receptor signaling pathway     105071674 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     105071674 (JUN)    04915 Estrogen signaling pathway     105071674 (JUN)    04921 Oxytocin signaling pathway     105071674 (JUN)    04926 Relaxin signaling pathway     105071674 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     105071674 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     105071674 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105071674 (JUN)    05207 Chemical carcinogenesis - receptor activation     105071674 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     105071674 (JUN)    05203 Viral carcinogenesis     105071674 (JUN)    05231 Choline metabolism in cancer     105071674 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105071674 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     105071674 (JUN)    05211 Renal cell carcinoma     105071674 (JUN)    05224 Breast cancer     105071674 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105071674 (JUN)    05170 Human immunodeficiency virus 1 infection     105071674 (JUN)    05161 Hepatitis B     105071674 (JUN)    05171 Coronavirus disease - COVID-19     105071674 (JUN)    05162 Measles     105071674 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     105071674 (JUN)    05169 Epstein-Barr virus infection     105071674 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     105071674 (JUN)    05135 Yersinia infection     105071674 (JUN)    05133 Pertussis     105071674 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105071674 (JUN)    05142 Chagas disease     105071674 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     105071674 (JUN)    05321 Inflammatory bowel disease     105071674 (JUN)   09165 Substance dependence    05030 Cocaine addiction     105071674 (JUN)    05031 Amphetamine addiction     105071674 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105071674 (JUN)    05418 Fluid shear stress and atherosclerosis     105071674 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105071674 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     105071674 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105071674 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cbai03000]     105071674 (JUN) Transcription factors [BR:cbai03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     105071674 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  105071674 NCBI-ProteinID:  XP_010956680 UniProt:  A0A9W3EUB7 LinkDB All DBs Position Unknown AA seq 335 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPASGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQPPQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMP GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaaaatcctgaagcagagcatgaccctg aacctggcagacccggtgggcagcctgaagccgcacctgcgggccaagaactccgacctc ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgatc atccagtccagcaacgggcacataaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggctgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggccagcggggcc ggcttggtggctccggcggtggcttcggtggcgggcggcagcggcagcggcggcttcagc gccagcctacacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgct ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagccgccgcagcagccaccacagccgccgcaccacctgccccagcagatcccc gtgcagcacccgcgtttgcaggccctgaaggaagagccgcagacggtgcccgagatgccc ggggaaacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggag aggaagcgcatgaggaaccgcatcgccgcctccaagtgccggaaaaggaagctggagagg atcgcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtcc acggccaacatgctcagggaacaggtggcccagcttaaacagaaagtcatgaaccacgtt aacagtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system