Camelus bactrianus (Bactrian camel): 105071699 Help Entry 105071699         CDS       T07534                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04382   Cornified envelope formation cbai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbai00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105071699 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105071699 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbai04147]     105071699 (S100A10) Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of microglial cells    105071699 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 TMP_3 Motif Other DBs NCBI-GeneID:  105071699 NCBI-ProteinID:  XP_010956700 UniProt:  A0A9W3GV25 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHRFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaaccatgatgttcacatttcacagatttgct ggggataaaggctacttaacaaaggaggacctgcgagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggccgtggacaagataatgaaggacctggac cagtgccgggacggcaaagtgggcttccagagcttcttctcgctgatcgccgggctcacc attgcatgcaatgactactttgtggtgcacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system