Camelus bactrianus (Bactrian camel): 105072076 Help Entry 105072076         CDS       T07534                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04015   Rap1 signaling pathway cbai04810   Regulation of actin cytoskeleton cbai05014   Amyotrophic lateral sclerosis cbai05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105072076 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105072076 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105072076 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105072076 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbai04131]     105072076 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cbai04812]     105072076 (PFN1)    04147 Exosome [BR:cbai04147]     105072076 (PFN1) Membrane trafficking [BR:cbai04131]  Others   Actin-binding proteins    Others     105072076 (PFN1) Cytoskeleton proteins [BR:cbai04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105072076 (PFN1) Exosome [BR:cbai04147]  Exosomal proteins   Proteins found in most exosomes    105072076 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105072076 NCBI-ProteinID:  XP_010957193 UniProt:  A0A9W3GVA6 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQN NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gttaacatcacgcctgctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctaacgcttgggggccagaaatgttctgtgatccgggactcactgctgcag gacggggaatttaccatggatcttcgtaccaagagcacgggcggagctcccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagaac tga

DBGET integrated database retrieval system