Camelus bactrianus (Bactrian camel): 105072342 Help Entry 105072342         CDS       T07534                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04024   cAMP signaling pathway cbai04080   Neuroactive ligand-receptor interaction cbai04081   Hormone signaling cbai04935   Growth hormone synthesis, secretion and action cbai04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     105072342 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     105072342 (SST)    04081 Hormone signaling     105072342 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     105072342 (SST)   09154 Digestive system    04971 Gastric acid secretion     105072342 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cbai04052]     105072342 (SST) Cytokines and neuropeptides [BR:cbai04052]  Neuropeptides   GPCR binding    105072342 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  105072342 NCBI-ProteinID:  XP_010957532 UniProt:  A0A9W3GVM6 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGSVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctctggga agtgtcaccggcgcgccctcggatccacgactccgtcagtttctgcagaagtctctggct gctgccgctgggaagcaggaactggccaagtacttcttggcagagctgctctctgaacct aaccagacagagaacgatgccctggagccggaagatctgtcccaggctgctgagcaggac gaaatgaggctggagctgcagagatccactaactcaaacccggccatggcacccagagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system