Camelus bactrianus (Bactrian camel): 105072353 Help Entry 105072353         CDS       T07534                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai03272   Virion - Hepatitis viruses cbai04382   Cornified envelope formation cbai04514   Cell adhesion molecules cbai04530   Tight junction cbai04670   Leukocyte transendothelial migration cbai05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cbai00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     105072353 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     105072353 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     105072353 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     105072353 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     105072353 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     105072353 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cbai03037]     105072353 (CLDN1)    04147 Exosome [BR:cbai04147]     105072353 (CLDN1)    04515 Cell adhesion molecules [BR:cbai04515]     105072353 (CLDN1) Cilium and associated proteins [BR:cbai03037]  Other cilia and associated proteins   Stereociliary proteins    105072353 (CLDN1) Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    105072353 (CLDN1)   Exosomal proteins of colorectal cancer cells    105072353 (CLDN1) Cell adhesion molecules [BR:cbai04515]  Immunoglobulin superfamily   L1 family    105072353 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC TMEM174 CD20 HAAS_TM SUR7 DUF7702 Cytochrom_B_C Amastin DUF2207_C DUF1218 DUF4064 Motif Other DBs NCBI-GeneID:  105072353 NCBI-ProteinID:  XP_010957550 UniProt:  A0A9W3GVC9 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGAIVSTALPQWKIYSYASDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLHSTLQATRALMVIGILLGLIAICVATVGMKCMKCLEDDEVQKMRMAV IGGVIFLISGLAVLVATAWYGNRIVQEFYDPMTPVNARYEFGHALFTGWAAASLTLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcagctgctgggcttcatcctggccttcctgggctggatcggc gccatcgtcagcacggcgctgccccagtggaagatttactcctacgccagcgacaacatc gtaacagcccaggccatctacgagggactgtggatgtcctgcgtgtcgcagagcaccggg cagatccagtgcaaagtcttcgactccttgctgaatctacacagtactttgcaagcaacc cgcgccttgatggtgattggcatcctgctgggactgatagccatttgtgtggccactgtt ggcatgaagtgtatgaagtgcctggaagatgatgaggtgcagaagatgcggatggctgtc attgggggcgtgatatttcttatttcaggtctggccgttttagtcgccacagcgtggtat ggcaatagaattgttcaggaattctatgaccccatgaccccggtcaatgccaggtatgaa tttggacatgctctcttcactggctgggctgctgcttctctcaccctcctgggaggcgcc ctgctttgctgctcgtgtccccggaaaacaacatcttacccaacgccacggccctacccg aaacctgcgccttccagtgggaaagactatgtgtga

DBGET integrated database retrieval system