Camelus bactrianus (Bactrian camel): 105073585 Help Entry 105073585         CDS       T07534                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai01521   EGFR tyrosine kinase inhibitor resistance cbai01524   Platinum drug resistance cbai04014   Ras signaling pathway cbai04064   NF-kappa B signaling pathway cbai04115   p53 signaling pathway cbai04137   Mitophagy - animal cbai04140   Autophagy - animal cbai04151   PI3K-Akt signaling pathway cbai04210   Apoptosis cbai04215   Apoptosis - multiple species cbai04621   NOD-like receptor signaling pathway cbai04630   JAK-STAT signaling pathway cbai05012   Parkinson disease cbai05014   Amyotrophic lateral sclerosis cbai05022   Pathways of neurodegeneration - multiple diseases cbai05145   Toxoplasmosis cbai05162   Measles cbai05166   Human T-cell leukemia virus 1 infection cbai05168   Herpes simplex virus 1 infection cbai05170   Human immunodeficiency virus 1 infection cbai05200   Pathways in cancer cbai05202   Transcriptional misregulation in cancer cbai05212   Pancreatic cancer cbai05220   Chronic myeloid leukemia cbai05222   Small cell lung cancer cbai05225   Hepatocellular carcinoma cbai05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105073585 (BCL2L1)    04630 JAK-STAT signaling pathway     105073585 (BCL2L1)    04064 NF-kappa B signaling pathway     105073585 (BCL2L1)    04151 PI3K-Akt signaling pathway     105073585 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105073585 (BCL2L1)    04137 Mitophagy - animal     105073585 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     105073585 (BCL2L1)    04215 Apoptosis - multiple species     105073585 (BCL2L1)    04115 p53 signaling pathway     105073585 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105073585 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105073585 (BCL2L1)    05202 Transcriptional misregulation in cancer     105073585 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     105073585 (BCL2L1)    05225 Hepatocellular carcinoma     105073585 (BCL2L1)    05220 Chronic myeloid leukemia     105073585 (BCL2L1)    05222 Small cell lung cancer     105073585 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105073585 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     105073585 (BCL2L1)    05162 Measles     105073585 (BCL2L1)    05168 Herpes simplex virus 1 infection     105073585 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105073585 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     105073585 (BCL2L1)    05014 Amyotrophic lateral sclerosis     105073585 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     105073585 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105073585 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105073585 (BCL2L1)    01524 Platinum drug resistance     105073585 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cbai01009]     105073585 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbai03036]     105073585 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cbai02000]     105073585 (BCL2L1) Protein phosphatases and associated proteins [BR:cbai01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      105073585 (BCL2L1) Chromosome and associated proteins [BR:cbai03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105073585 (BCL2L1) Transporters [BR:cbai02000]  Other transporters   Pores ion channels [TC:1]    105073585 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  105073585 NCBI-ProteinID:  XP_010959194 UniProt:  A0A9W3EXX7 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSLSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctctgagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaagccccagaaggg actgaatcagagatggaaacccccagtgccatcaatggcaacccatcctggcacctggca gacagccccgcggtgaatggagccactggccacagcagcagcttggatgcgcgggaggtg atccccatggcagcggtgaagcaagcgctgagggaggcgggtgatgagtttgaactgagg taccggcgagcattcagtgacctgacgtcccagctccacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgatcacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaacgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggtgtggttctgctgggctcgcttttcagtcggaaatga

DBGET integrated database retrieval system