Camelus bactrianus (Bactrian camel): 105078703 Help Entry 105078703         CDS       T07534                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04978   Mineral absorption Brite KEGG Orthology (KO) [BR:cbai00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105078703  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cbai03019]     105078703    03029 Mitochondrial biogenesis [BR:cbai03029]     105078703 Messenger RNA biogenesis [BR:cbai03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105078703 Mitochondrial biogenesis [BR:cbai03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105078703 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105078703 NCBI-ProteinID:  XP_010965622 UniProt:  A0A9W3F690 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCSAGESCSCPGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggatcctaactgctcctgctccgccggtgaatcctgctcgtgtcctggctcctgcaaa tgcaaagagtgcaaatgcacctcctgcaagaagagttgctgctcctgctgcccagtgggc tgtgccaagtgcgcccagggctgcatctgcaaaggggcgtcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system