Camelus bactrianus (Bactrian camel): 105080964 Help Entry 105080964         CDS       T07534                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04621   NOD-like receptor signaling pathway cbai05012   Parkinson disease cbai05132   Salmonella infection cbai05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cbai00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105080964 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105080964 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     105080964 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105080964 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cbai03110]     105080964 (TXN) Chaperones and folding catalysts [BR:cbai03110]  Protein folding catalysts   Protein disulfide isomerase    105080964 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  105080964 NCBI-ProteinID:  XP_010968393 UniProt:  A0A9W3FA26 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagcaagtatgcttttcaggaagccttgaacagtgcgggagat aagctggtggtagtcgacttctcggccacgtggtgcgggccctgcaaaatgatcaagcct ttcttccactctctctctgaaaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggacgttgcttcagagtgtgaagttaaatgcatgccaaccttccagtttttt aaaaagggacaaaaggtgggcgaattttctggcgctaataaggaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system