Camelus bactrianus (Bactrian camel): 105082405 Help Entry 105082405         CDS       T07534                                  Name (RefSeq) histone H2A type 2-C-like   KO K11251   histone H2A Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai03082   ATP-dependent chromatin remodeling cbai04217   Necroptosis cbai04613   Neutrophil extracellular trap formation cbai05034   Alcoholism cbai05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cbai00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105082405  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105082405  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105082405  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     105082405   09165 Substance dependence    05034 Alcoholism     105082405  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbai03036]     105082405   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbai04147]     105082405 Chromosome and associated proteins [BR:cbai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105082405 Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105082405 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Histone_H2A_C Motif Other DBs NCBI-GeneID:  105082405 NCBI-ProteinID:  XP_010970280 UniProt:  A0A9W3H458 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTI NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagcaaggaggcaaggcccgcgctaaggccaagtctcgctcgtcc cgcgctggtctgcagtttccggtggggcgagtgcaccgcctgctgcggaaaggcaactac gccgagcgagtgggagctggcgccccagtctacatggcggcggttctcgagtacctgacg gctgaaattctggagctggcgggcaacgcggcgcgagacaacaagaagacgcgcatcatc cctcgccatttgcagctggctatccgcaacgatgaggagctgaacaagctgctgggcaaa gtcaccatc

DBGET integrated database retrieval system