Camelus bactrianus (Bactrian camel): 105082521 Help Entry 105082521         CDS       T07534                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04140   Autophagy - animal cbai04144   Endocytosis cbai04152   AMPK signaling pathway cbai04530   Tight junction cbai04972   Pancreatic secretion cbai05014   Amyotrophic lateral sclerosis cbai05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:cbai00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     105082521 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105082521 (RAB8A)    04140 Autophagy - animal     105082521 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     105082521 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     105082521 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105082521 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     105082521 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbai04131]     105082521 (RAB8A)    03036 Chromosome and associated proteins [BR:cbai03036]     105082521 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbai04147]     105082521 (RAB8A)    04031 GTP-binding proteins [BR:cbai04031]     105082521 (RAB8A) Membrane trafficking [BR:cbai04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     105082521 (RAB8A)  Autophagy   Other autophagy associated proteins     105082521 (RAB8A) Chromosome and associated proteins [BR:cbai03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105082521 (RAB8A) Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105082521 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    105082521 (RAB8A)   Exosomal proteins of colorectal cancer cells    105082521 (RAB8A) GTP-binding proteins [BR:cbai04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     105082521 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc DUF3963 Motif Other DBs NCBI-GeneID:  105082521 NCBI-ProteinID:  XP_010970384 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSRERGEKLAL DYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSF FRCVLL NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccggaac tggattcggaacattgaggagcacgcctctgcagatgtcgaaaagatgatactcgggaac aagtgcgacgtgaacgacaagagacaagtttccagggaacggggagagaagctggccctg gactatggaatcaagttcatggagaccagcgcaaaggccaacatcaacgtggagaacgca tttttcactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaacagc ccccaggggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagcttt ttccgatgtgttcttctgtga

DBGET integrated database retrieval system