Camelus bactrianus (Bactrian camel): 105084182 Help Entry 105084182         CDS       T07534                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism cbai  Camelus bactrianus (Bactrian camel) Pathway cbai04613   Neutrophil extracellular trap formation cbai05034   Alcoholism cbai05203   Viral carcinogenesis cbai05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cbai00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105084182  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105084182   09163 Immune disease    05322 Systemic lupus erythematosus     105084182   09165 Substance dependence    05034 Alcoholism     105084182  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbai03036]     105084182   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbai04147]     105084182 Chromosome and associated proteins [BR:cbai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105084182 Exosome [BR:cbai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105084182 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like ARM_TT21 TFIID_20kDa Motif Other DBs NCBI-GeneID:  105084182 NCBI-ProteinID:  XP_010972525 UniProt:  A0A9W3FG30 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MPELTSKGSTISKKGFKNAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVSDIFERIAGEASRLAHYNKRLTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagagctgacttcaaagggctctaccatttctaagaaaggcttcaaaaatgctgta actaaaacccagaagaaggaagggaaaaagcgcaagagatgtcgcaaagagagctattca atttacatctacaaggtgctgaagcaagttcaccccgataccggtatctcttcaaaggcc atgagcatcatgaattcttttgtcagtgatattttcgagcgcatcgcgggcgaggcatcg cgcctggcgcattacaacaagcgcttgaccatcacgtcccgggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgccgtgtctgagggcaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system