Mycovorax composti: PIECOFPK_00107 Help Entry PIECOFPK_00107    CDS       T10380                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism cbam  Mycovorax composti Pathway cbam01100   Metabolic pathways cbam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PIECOFPK_00107 (acpP_1)    00074 Mycolic acid biosynthesis     PIECOFPK_00107 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PIECOFPK_00107 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF2624 Motif Other DBs NCBI-ProteinID:  WWC82404 UniProt:  A0ABZ2EFY9 LinkDB All DBs Position 131394..131630 Genome browser AA seq 78 aa AA seqDB search MSDIATRVKKIIVDKLGVDEAEVTNEASFTNDLGADSLDTVELIMEFEKEFNISIPDEQA ETITTVGQAVSYLEEHAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagacattgcaacaagagttaaaaaaatcatcgttgacaaattaggtgttgacgaa gcagaagtaactaacgaagcgtcttttaccaatgacctgggcgctgattctttagatact gttgaactgattatggaatttgaaaaagagtttaatatttctattcccgacgaacaggct gaaaccatcaccactgttggacaggctgtttcatatttagaagaacacgctaaataa

DBGET integrated database retrieval system