Mycovorax composti: PIECOFPK_00432 Help Entry PIECOFPK_00432    CDS       T10380                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism cbam  Mycovorax composti Pathway cbam01100   Metabolic pathways cbam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PIECOFPK_00432 (acpP_2)    00074 Mycolic acid biosynthesis     PIECOFPK_00432 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PIECOFPK_00432 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WWC82723 UniProt:  A0ABZ2EGV9 LinkDB All DBs Position 532310..532573 Genome browser AA seq 87 aa AA seqDB search MEREALKQQVKEQIVKFLNLNTVNPADIKDDEPLFGEGLGLDSIDSIELIVMLSREYGIN IQDPKEGRKVLTSVNTMVDYIEQHRTK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaaagagaagcgctgaaacagcaggtcaaggaacagattgtcaagtttttaaatctg aataccgtaaatcctgctgatattaaagatgacgaacctttgtttggagaaggcctcggg ctcgactctatcgattcgatagaactgattgttatgctatcaagagaatacggcatcaat attcaggaccccaaggaaggccgtaaagttcttaccagcgtaaacacaatggtcgattat attgagcagcatcgcacaaaataa

DBGET integrated database retrieval system