Coxiella burnetii CbuK_Q154: CbuK_1319
Help
Entry
CbuK_1319 CDS
T00788
Symbol
aspC
Name
(GenBank) aspartate aminotransferase
KO
K00812
aspartate aminotransferase [EC:
2.6.1.1
]
Organism
cbc
Coxiella burnetii CbuK_Q154
Pathway
cbc00220
Arginine biosynthesis
cbc00250
Alanine, aspartate and glutamate metabolism
cbc00270
Cysteine and methionine metabolism
cbc00330
Arginine and proline metabolism
cbc00400
Phenylalanine, tyrosine and tryptophan biosynthesis
cbc01100
Metabolic pathways
cbc01110
Biosynthesis of secondary metabolites
cbc01210
2-Oxocarboxylic acid metabolism
cbc01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
cbc00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
CbuK_1319 (aspC)
00270 Cysteine and methionine metabolism
CbuK_1319 (aspC)
00220 Arginine biosynthesis
CbuK_1319 (aspC)
00330 Arginine and proline metabolism
CbuK_1319 (aspC)
00350 Tyrosine metabolism
CbuK_1319 (aspC)
00360 Phenylalanine metabolism
CbuK_1319 (aspC)
00400 Phenylalanine, tyrosine and tryptophan biosynthesis
CbuK_1319 (aspC)
09110 Biosynthesis of other secondary metabolites
00401 Novobiocin biosynthesis
CbuK_1319 (aspC)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
cbc01007
]
CbuK_1319 (aspC)
Enzymes [BR:
cbc01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.1 aspartate transaminase
CbuK_1319 (aspC)
Amino acid related enzymes [BR:
cbc01007
]
Aminotransferase (transaminase)
Class I
CbuK_1319 (aspC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Aminotran_5
Asp_aminotransf
DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID:
ACJ20499
LinkDB
All DBs
Position
1286300..1287571
Genome browser
AA seq
423 aa
AA seq
DB search
MTFQKPCFPHCLPVYFPLLYHSNHKELRKMNDVLSVRAQQLEPSVTLAVSDLARELLNKG
HDVISLSAGEPDFDTPDFIKQSAIKAIQEGFTKYTNVDGTPALKAAIVHKLKRDNHLNYE
PSEILVSGGAKQSIYNALMGTLNAGDEAIIPAPYWVSYPPMVQLAEAKPIIISATIDQNF
KLTPGQLSQAITPQSRLLILNSPNNPSGVAYTESELKALADVLMEHPQILILSDEIYEYI
LWGQNRFVNILNVCPELRDRTIIINGASKAYAMTGWRIGYAAGPKSIIQAMKKIQSQSTS
SPNSIAQVAATTALGAQRGDFAYMYEAYKTRHDLVLKALNQMKGVHCIPADGAFYLFPDV
SAAIQQLGLEDDIKLGTYLLDKTKVAVVPGSAFGSPGHVRLSCATSTEKLQEALERLASV
LDY
NT seq
1272 nt
NT seq
+upstream
nt +downstream
nt
ttgacatttcagaaaccctgctttccccattgtttaccggtatattttccgctactctac
cacagcaatcataaggagcttagaaaaatgaatgatgtcttatccgtccgagcgcaacaa
cttgaaccctcagtaacattggctgtctccgatctcgcacgcgagcttttaaacaagggc
catgacgtgatcagtctcagcgcaggtgaaccggattttgacaccccggactttatcaaa
cagtccgccattaaagcaattcaagaaggctttaccaaatacaccaatgtagacggaact
cctgccctaaaagcggcgattgtccataaattaaagcgcgataatcacttaaactacgag
ccttctgaaatactggtcagcggcggagccaaacaatcgatctataacgccctgatggga
acgctaaatgcgggggacgaagccatcattcctgccccttattgggtgagctatccacca
atggtacaactggcggaagcaaaacccattattatctcagcgaccattgaccaaaatttt
aaactcactcccggtcagctctctcaagcgattactccccaatcgcgactgctgatttta
aacagtcccaacaacccttccggagttgcttacactgaaagtgaattaaaggcgttggca
gacgttttgatggagcatccccaaattttaattctttccgatgaaatttatgaatatatt
ctgtggggacaaaaccgttttgtaaatatccttaacgtttgcccggaattgcgcgatcgc
actatcattatcaacggcgcttccaaggcttatgccatgaccggatggcgaattggttat
gcggctggtcctaaatcgattattcaggcaatgaaaaaaattcaatctcagagtacttct
tctcccaattcgattgcccaagtcgctgccacgacagcactcggcgctcagcgcggtgat
tttgcttacatgtatgaggcttataaaacacgccacgatttggtgctgaaagcccttaat
caaatgaaaggtgttcactgcattcccgctgacggcgccttttacctcttccccgatgtt
tcggctgccatccaacagctcggattagaggatgacatcaaactcggaacgtacttattg
gataaaacgaaagttgccgtcgtccccggaagcgcctttggctcgcccggacacgttcgc
ctttcttgtgcaaccagcaccgaaaaattgcaagaagccctggagcggttagcgtcggta
ctggattattag
DBGET
integrated database retrieval system