Cercospora beticola: CB0940_11950 Help Entry CB0940_11950      CDS       T09388                                  Name (RefSeq) Dynein light chain, cytoplasmic   KO K10418   dynein light chain LC8-type Organism cbet  Cercospora beticola Pathway cbet04145   Phagocytosis cbet04517   IgSF CAM signaling cbet04814   Motor proteins Brite KEGG Orthology (KO) [BR:cbet00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CB0940_11950  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     CB0940_11950   09142 Cell motility    04814 Motor proteins     CB0940_11950  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cbet03037]     CB0940_11950    04812 Cytoskeleton proteins [BR:cbet04812]     CB0940_11950 Cilium and associated proteins [BR:cbet03037]  Motile cilia and associated proteins   Dynein arm    CB0940_11950 Cytoskeleton proteins [BR:cbet04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CB0940_11950 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Cwc21_C Enoyl_reductase WHD_GDS1 Motif Other DBs NCBI-GeneID:  35435754 NCBI-ProteinID:  XP_023460660 LinkDB All DBs Position 10 Genome browser AA seq 95 aa AA seqDB search MADDKHDEKLEAQIKSVDMNEDMQQEAIEVAQEAMNKFTIEKEIAQHIKRTFDERKGATW HCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcagacgacaagcatgacgagaagcttgaggctcagatcaaatcggtggacatgaac gaggacatgcagcaagaagccattgaagtcgcacaagaagcaatgaacaagttcaccatt gagaaggaaatcgctcagcacatcaagcgcacgttcgatgaacgcaagggtgcaacatgg cattgcatcgtgggcaggaactttgggtcattcgtcactcatgagacgaagcatttcatc tatttctaccttggtcactgcgcaatcctgctgttcaagacgcagtag

DBGET integrated database retrieval system