Candidatus Competibacteraceae bacterium Lyne_18-Q3-R50-59_BATAC.383_cln: IPM89_09330
Help
Entry
IPM89_09330 CDS
T10208
Name
(GenBank) PLP-dependent aminotransferase family protein
KO
K05825
2-aminoadipate transaminase [EC:2.6.1.-]
Organism
cbly Candidatus Competibacteraceae bacterium Lyne_18-Q3-R50-59_BATAC.383_cln
Pathway
cbly00300
Lysine biosynthesis
cbly00630
Glyoxylate and dicarboxylate metabolism
cbly01100
Metabolic pathways
cbly01110
Biosynthesis of secondary metabolites
cbly01210
2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:
cbly00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
IPM89_09330
09105 Amino acid metabolism
00300 Lysine biosynthesis
IPM89_09330
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Asp_aminotransf
Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID:
QQS53127
LinkDB
All DBs
Position
2090689..2091885
Genome browser
AA seq
398 aa
AA seq
DB search
MFSERIDRLTSSLIRELLALTQKPDIISFAGGLPAREAMPPLQLTDLPPELSQYGTTDGE
PELRAAIAGQLADLGLRCRPEQILITTGSQQGIDLVSKLYIDPGTPVAVEAPSYLAALQS
FRLFGARFEELPLTANGIDPDQLRQAIQRQRPAFVYLIPTFQNPAGVCYDEATRAAVAAV
LRETGTPLLEDEPYRELVYEPVDRGPLCARLEDGQTWMYMGTFSKTGIPGLRVGYVAASE
DVHAYLVRLKQSTDLHTNRIGQWWCARFLNSRDYPAHLERLRAFYRERRDAMQAALTRHL
GDLAEWTMPNGGLFFWVRLKAGGDTRALLVRALERKVAFMPGEAFFASANAMHGAFMRLN
FSHATPEQLERGLAVLAEVIREQRGMAKTEAGAGVVAI
NT seq
1197 nt
NT seq
+upstream
nt +downstream
nt
atgttctccgaacgcatcgatcgtctgaccagctccctgatccgggaactgctcgccctt
actcagaaacccgacatcatctcctttgccggtggcctgccggcgcgcgaggccatgccg
ccgctgcaactgaccgacctaccccccgagctgagccagtacggcaccaccgacggcgaa
ccggaactgcgcgccgccatcgccgggcagttggcggatcttggtttgcgctgccggccg
gagcagattctgatcaccaccggttcgcagcagggcatcgatctggtttccaaactctac
atcgatcccggcacaccggtggcggtggaagcgccgagctatctggcggcgctgcaatcg
ttccggctgttcggcgcccgtttcgaggaactgccgctgacggccaacggcatcgacccg
gatcagttgcggcaagcgatccagcgccagcggccggcattcgtctacctgattcccacc
ttccagaacccggccggagtctgttacgacgaagccacccgcgcggcggtcgcggcggtg
ctacgcgagaccggcacgccactgctggaggatgaaccgtatcgggagctggtctacgag
ccggtggatcgcggcccgctgtgcgcccggctggaagatggccaaacctggatgtacatg
ggcactttctccaagaccggcatccccggcctgcgggtcggctatgtggcggcctccgag
gacgtccacgcttatctggtgcgactcaaacaatccaccgatctgcacaccaaccggatt
ggtcaatggtggtgcgcccggtttctgaactcgcgcgactatccggcgcatctggagcgg
ttgcgggccttctaccgcgaacggcgcgatgccatgcaggcggcgctgacccggcatctc
ggcgacttggccgagtggacgatgcccaacggtgggctgttcttctgggtgcggctaaag
gctggtggcgacactcgtgccctgctggtgcgggcactggagcgcaaggtggcgttcatg
ccgggcgaggcattctttgccagcgccaacgcgatgcacggcgccttcatgcggctgaat
ttcagccacgccacgcccgagcaactggagcgcggcctggcggtgctggcggaggtcatt
cgggaacagcggggaatggcgaagacggaagcgggggctggggtggtggcgatttag
DBGET
integrated database retrieval system