Candidatus Viadribacter manganicus: ATE48_00185 Help Entry ATE48_00185       CDS       T04422                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism cbot  Candidatus Viadribacter manganicus Brite KEGG Orthology (KO) [BR:cbot00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cbot03032]     ATE48_00185    03036 Chromosome and associated proteins [BR:cbot03036]     ATE48_00185    03400 DNA repair and recombination proteins [BR:cbot03400]     ATE48_00185 DNA replication proteins [BR:cbot03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ATE48_00185 Chromosome and associated proteins [BR:cbot03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ATE48_00185 DNA repair and recombination proteins [BR:cbot03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ATE48_00185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Lmo2446-like_N LeuA_dimer Motif Other DBs NCBI-ProteinID:  ANP44450 UniProt:  A0A1B1AD18 LinkDB All DBs Position 32553..32822 Genome browser AA seq 89 aa AA seqDB search MNKAEFVADVSERIGESKQRGEEVVNAVFEALTAALKRGDEVRLPQFGVFLVSETKERKA RNPQTGEEVIVPAGKRPKFRAGKALKEAI NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaataaagcagagttcgttgccgacgtgtccgagcgtatcggcgagtcgaagcaacgg ggcgaagaagtcgtcaacgcagtgtttgaagctcttacggccgcactgaagcgcggcgac gaagtgcgcttgccgcagttcggtgtttttctcgtttcggaaacgaaggagcgcaaggcc cgtaatccgcagaccggtgaagaggtcatcgtgccggcaggtaagcggccaaaattccgg gccggcaaggcgctcaaagaagcgatctga

DBGET integrated database retrieval system