Candidatus Viadribacter manganicus: ATE48_14165 Help Entry ATE48_14165       CDS       T04422                                  Name (GenBank) hypothetical protein   KO K03073   preprotein translocase subunit SecE Organism cbot  Candidatus Viadribacter manganicus Pathway cbot02024   Quorum sensing cbot03060   Protein export cbot03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cbot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ATE48_14165  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ATE48_14165  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ATE48_14165  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cbot02044]     ATE48_14165 Secretion system [BR:cbot02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    ATE48_14165 SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  ANP48089 UniProt:  A0A1B1ANE6 LinkDB All DBs Position 2777714..2777950 Genome browser AA seq 78 aa AA seqDB search MDQTDQEVEPRRKGGGPFKFFGEVRSEARKVTWATRQEVTVSTIMVVIFGITAAIFFFLV DTLLRLFMQFVLSFSLGG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaccaaaccgatcaggaagttgaaccgcggcgcaagggcggcggtccgttcaagttc tttggcgaggtgcgctcggaggcgcgcaaggtcacctgggcgacgcgtcaggaagtgacc gtctcgaccattatggtggtcatcttcggcatcactgccgcgattttctttttcctcgtc gacacgctgctgcgcttgttcatgcagtttgtcttgagtttcagtttgggtggttga

DBGET integrated database retrieval system