Candidatus Viadribacter manganicus: ATE48_18290 Help Entry ATE48_18290       CDS       T04422                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism cbot  Candidatus Viadribacter manganicus Pathway cbot03060   Protein export cbot03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cbot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ATE48_18290  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ATE48_18290  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cbot02044]     ATE48_18290 Secretion system [BR:cbot02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    ATE48_18290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANP47711 UniProt:  A0A1B1AME3 LinkDB All DBs Position 3569562..3569771 Genome browser AA seq 69 aa AA seqDB search MPGLIPLLIVLGLAFLLFSRPGRISSLMEDLGKGISGFRKGLSEGDKPPAQEPPPAQVRD QSTNGDRAQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcctggccttattccgctcctcatcgtgctggggctggccttcctgctgttcagccgt ccgggccgcatttcgagcctgatggaagatctcggcaaaggtatctccggcttccgcaag ggtctgagcgagggcgacaagccgcccgcgcaagagccgccgccagcccaggtgcgcgac cagtccaccaacggagaccgcgcgcaataa

DBGET integrated database retrieval system