Ciconia boyciana (Oriental stork): 140643281 Help Entry 140643281         CDS       T10948                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04010   MAPK signaling pathway cboy04012   ErbB signaling pathway cboy04068   FoxO signaling pathway cboy04137   Mitophagy - animal cboy04140   Autophagy - animal cboy04150   mTOR signaling pathway cboy04210   Apoptosis cboy04218   Cellular senescence cboy04370   VEGF signaling pathway cboy04371   Apelin signaling pathway cboy04540   Gap junction cboy04625   C-type lectin receptor signaling pathway cboy04810   Regulation of actin cytoskeleton cboy04910   Insulin signaling pathway cboy04912   GnRH signaling pathway cboy04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cboy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     140643281 (NRAS)    04012 ErbB signaling pathway     140643281 (NRAS)    04370 VEGF signaling pathway     140643281 (NRAS)    04371 Apelin signaling pathway     140643281 (NRAS)    04068 FoxO signaling pathway     140643281 (NRAS)    04150 mTOR signaling pathway     140643281 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     140643281 (NRAS)    04137 Mitophagy - animal     140643281 (NRAS)   09143 Cell growth and death    04210 Apoptosis     140643281 (NRAS)    04218 Cellular senescence     140643281 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     140643281 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     140643281 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     140643281 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     140643281 (NRAS)    04912 GnRH signaling pathway     140643281 (NRAS)    04916 Melanogenesis     140643281 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cboy04131]     140643281 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cboy04147]     140643281 (NRAS)    04031 GTP-binding proteins [BR:cboy04031]     140643281 (NRAS) Membrane trafficking [BR:cboy04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     140643281 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     140643281 (NRAS) Exosome [BR:cboy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    140643281 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    140643281 (NRAS)   Exosomal proteins of breast cancer cells    140643281 (NRAS)   Exosomal proteins of colorectal cancer cells    140643281 (NRAS) GTP-binding proteins [BR:cboy04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     140643281 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  140643281 NCBI-ProteinID:  XP_072700957 LinkDB All DBs Position 23:314153..317880 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtcggcaagagcgcgctgacc atccagctgatccagaaccacttcgtggacgagtacgaccccaccatcgaggattcgtat agaaagcaggttgttattgatggagagacgtgcttgttagacatcctggacactgcggga caggaagagtatagtgccatgcgcgaccagtacatgagaactggggaaggattcctctgt gtttttgccattaacaacagtaaatcgtttgctgatattaacctttacagagaacagatc aagagagtgaaagattcagatgatgtgccaatggtgctagttgggaataagtgtgatttg cccacaagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatcccc ttcatagagacatctgctaaaacaagacagggcgtggaagatgctttttacacgctggtg agagagatccggcagtaccggatgaaaaagctcaacagcaacgaagatgggaatcaaggc tgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system