Ciconia boyciana (Oriental stork): 140644036 Help Entry 140644036         CDS       T10948                                  Symbol APOA2 Name (RefSeq) apolipoprotein A-II   KO K08758   apolipoprotein A-II Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:cboy00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     140644036 (APOA2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cboy04147]     140644036 (APOA2) Exosome [BR:cboy04147]  Exosomal proteins   Exosomal proteins of other cancer cells    140644036 (APOA2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ApoA-II Apolipoprotein DUF883 C1ORF64 Motif Other DBs NCBI-GeneID:  140644036 NCBI-ProteinID:  XP_072702599 LinkDB All DBs Position 26:complement(3327614..3328019) Genome browser AA seq 104 aa AA seqDB search MKVLAAALLLLLCACRLQAALVRREAPPEEAPTPASDPITHHLQSFSSFMTKDLPQRLQV EELRSQAEAYLDRAKKQLVPLAQELQSNILGLFSSLLELGEGQA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaaggtgctggcggccgccctgctgctgctgctctgcgcctgccgcctccaggccgcc ctggtgaggcgcgaggccccacccgaggaggcccccaccccggccagcgaccccatcacc caccatctgcagtccttctcctccttcatgaccaaggacctgccccagaggctgcaggtg gaggagctgcgcagccaggccgaggcctacctggaccgggccaaaaagcagctggtgccg ctggcccaggagctgcagagcaacattctcggcctcttctcctccctgctggagctgggc gaggggcaagcctga

DBGET integrated database retrieval system