Ciconia boyciana (Oriental stork): 140645644 Help Entry 140645644         CDS       T10948                                  Symbol ELOB Name (RefSeq) LOW QUALITY PROTEIN: elongin-B   KO K03873   elongin-B Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cboy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     140645644 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cboy04121]     140645644 (ELOB)    03400 DNA repair and recombination proteins [BR:cboy03400]     140645644 (ELOB) Ubiquitin system [BR:cboy04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      140645644 (ELOB)    Cul5 complex      140645644 (ELOB) DNA repair and recombination proteins [BR:cboy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      140645644 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  140645644 NCBI-ProteinID:  XP_072705192 LinkDB All DBs Position 36 Genome browser AA seq 135 aa AA seqDB search MAAAPPPPPPPDLLKMADVFLMIRRHKTTIFTDAKESSTVYELKRIVEGILKRXPEEQRL YKDDQLLEDTKTLGDCGFTSQTARPQAPATVGLALRTAEEAFEALRIDPFSSPPELPDVM KPQDSTGGAQEPPLP NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcgccccccccaccccccccgccggacctcctcaaaatggcggacgtcttc ctgatgatccggcgccacaagaccaccatcttcacggacgccaaggagtccagcaccgtc tacgagctgaagcgcatcgtggagggcatcctcaagcggncccccgaggagcagcgcctc tataaggacgatcagctgctggaggacaccaagacgctgggggactgcggcttcaccagc caaaccgcccgcccccaggcccccgccaccgtggggctggcgctgcgcaccgccgaggag gctttcgaggcgctgcgcatcgaccccttctccagcccccccgagctccccgacgtcatg aagccgcaggattccaccggcggcgcccaggagcccccgctgccctga

DBGET integrated database retrieval system