Ciconia boyciana (Oriental stork): 140646099 Help Entry 140646099         CDS       T10948                                  Symbol IGF1 Name (RefSeq) insulin-like growth factor 1   KO K05459   insulin-like growth factor 1 Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04010   MAPK signaling pathway cboy04068   FoxO signaling pathway cboy04081   Hormone signaling cboy04114   Oocyte meiosis cboy04115   p53 signaling pathway cboy04150   mTOR signaling pathway cboy04510   Focal adhesion cboy04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cboy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     140646099 (IGF1)    04068 FoxO signaling pathway     140646099 (IGF1)    04150 mTOR signaling pathway     140646099 (IGF1)   09133 Signaling molecules and interaction    04081 Hormone signaling     140646099 (IGF1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     140646099 (IGF1)    04115 p53 signaling pathway     140646099 (IGF1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     140646099 (IGF1)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     140646099 (IGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cboy04052]     140646099 (IGF1) Cytokines and neuropeptides [BR:cboy04052]  Cytokines   Growth factors (RTK binding)    140646099 (IGF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  140646099 NCBI-ProteinID:  XP_072705592 LinkDB All DBs Position 1:63007180..63065642 Genome browser AA seq 153 aa AA seqDB search MEKINSLSTQLVKCCFCDFLKVKMHTVSYIHFFYLGLCLLTLTSSAAAGPETLCGAELVD ALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARS VRAQRHTDMPKAQKEVHLKNTSRGNTGNRNYRM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaatcaacagtctttcaacacaattagttaagtgctgcttttgtgatttcttg aaggtgaagatgcacactgtgtcctacattcatttcttctaccttggcctgtgtttgctt accttaaccagttctgctgctgctggcccagaaacactctgtggtgctgagctggttgat gctcttcagttcgtgtgtggagacagaggcttttacttcagtaagcctacagggtatgga tccagcagtagacgcttacaccacaagggaatagtggatgaatgctgcttccagagttgt gacctgaggaggctggagatgtattgtgctccaataaagccacctaaatctgcacgctct gtacgtgctcagcgccacactgatatgccaaaagcacaaaaggaagtgcatttgaagaat acaagtagagggaacacaggaaacagaaactacagaatgtaa

DBGET integrated database retrieval system