Ciconia boyciana (Oriental stork): 140649160 Help Entry 140649160         CDS       T10948                                  Symbol UCN Name (RefSeq) urocortin   KO K23142   urocortin Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04080   Neuroactive ligand-receptor interaction cboy04081   Hormone signaling Brite KEGG Orthology (KO) [BR:cboy00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     140649160 (UCN)    04081 Hormone signaling     140649160 (UCN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cboy04052]     140649160 (UCN) Cytokines and neuropeptides [BR:cboy04052]  Neuropeptides   GPCR binding    140649160 (UCN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CRF Motif Other DBs NCBI-GeneID:  140649160 NCBI-ProteinID:  XP_072712040 LinkDB All DBs Position 3:376818..377423 Genome browser AA seq 101 aa AA seqDB search MRRALLTLLLLLARPQPAAARPARPDGSVPAAAAGAEERGRPLWPPLAPPPPEPWRARRD EPPLSIDLTFHLLRHLLLLARAQSQRARADSNRLILDAVGR NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgcggcgggcgctgctcaccctcctgctgctgctcgcccgcccgcagcccgccgccgcc cgccccgcgcgccccgacggctccgtcccggcggccgcggccggggccgaggagcggggc cgcccgctctggccgccgctggcgccgccgcccccggagccgtggcgggcgcggcgggac gagccgccgctctccatcgacctcaccttccacctcctgcggcacctcctgctgctcgcc cgcgcccagagccagcgcgcccgcgccgacagcaaccgcctcatcctcgacgccgtaggg cgctga

DBGET integrated database retrieval system