Ciconia boyciana (Oriental stork): 140653009 Help Entry 140653009         CDS       T10948                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy03030   DNA replication cboy03410   Base excision repair cboy03420   Nucleotide excision repair cboy03430   Mismatch repair cboy03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cboy00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     140653009 (POLD4)    03410 Base excision repair     140653009 (POLD4)    03420 Nucleotide excision repair     140653009 (POLD4)    03430 Mismatch repair     140653009 (POLD4)    03440 Homologous recombination     140653009 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cboy03032]     140653009 (POLD4)    03400 DNA repair and recombination proteins [BR:cboy03400]     140653009 (POLD4) DNA replication proteins [BR:cboy03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     140653009 (POLD4) DNA repair and recombination proteins [BR:cboy03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       140653009 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      140653009 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  140653009 NCBI-ProteinID:  XP_072720680 LinkDB All DBs Position 6:2218225..2219170 Genome browser AA seq 122 aa AA seqDB search MEQPRRITDSFPRRRRAGRAPGRDKGKGKGKVKGRGCPRARPRVPPPAEEPPAAPPDPAL LEMLRRFDLAWEYGPCTGITRLQRWERAQAQGLSPPAPVREALLEHRDNPDVTYSLWHEY AL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggagcagccccggcggatcaccgactccttcccgcggcggcggcgagcggggcgagcc ccgggcagggacaagggcaagggcaagggcaaggtcaagggcaggggctgtccccgggcc cggccccgcgtccccccgcccgccgaggagcccccggccgcccccccggacccggccctc ctggagatgctgcgccgcttcgacctcgcctgggagtacgggccctgcaccggtatcacc cgcctgcagcgctgggagcgggcgcaggcgcaggggctgagccccccggcccccgtgcgc gaagccctcctggagcaccgggacaaccccgatgtcacctacagcctctggcatgagtac gccctctga

DBGET integrated database retrieval system