Ciconia boyciana (Oriental stork): 140653532 Help Entry 140653532         CDS       T10948                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04010   MAPK signaling pathway cboy04012   ErbB signaling pathway cboy04068   FoxO signaling pathway cboy04137   Mitophagy - animal cboy04140   Autophagy - animal cboy04144   Endocytosis cboy04150   mTOR signaling pathway cboy04210   Apoptosis cboy04218   Cellular senescence cboy04370   VEGF signaling pathway cboy04371   Apelin signaling pathway cboy04510   Focal adhesion cboy04540   Gap junction cboy04625   C-type lectin receptor signaling pathway cboy04810   Regulation of actin cytoskeleton cboy04910   Insulin signaling pathway cboy04912   GnRH signaling pathway cboy04916   Melanogenesis cboy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cboy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     140653532 (HRAS)    04012 ErbB signaling pathway     140653532 (HRAS)    04370 VEGF signaling pathway     140653532 (HRAS)    04371 Apelin signaling pathway     140653532 (HRAS)    04068 FoxO signaling pathway     140653532 (HRAS)    04150 mTOR signaling pathway     140653532 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     140653532 (HRAS)    04140 Autophagy - animal     140653532 (HRAS)    04137 Mitophagy - animal     140653532 (HRAS)   09143 Cell growth and death    04210 Apoptosis     140653532 (HRAS)    04218 Cellular senescence     140653532 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     140653532 (HRAS)    04540 Gap junction     140653532 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     140653532 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     140653532 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     140653532 (HRAS)    04912 GnRH signaling pathway     140653532 (HRAS)    04916 Melanogenesis     140653532 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     140653532 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cboy04131]     140653532 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cboy04147]     140653532 (HRAS)    04031 GTP-binding proteins [BR:cboy04031]     140653532 (HRAS) Membrane trafficking [BR:cboy04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     140653532 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     140653532 (HRAS) Exosome [BR:cboy04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    140653532 (HRAS)   Exosomal proteins of colorectal cancer cells    140653532 (HRAS) GTP-binding proteins [BR:cboy04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     140653532 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  140653532 NCBI-ProteinID:  XP_072721805 LinkDB All DBs Position 6:21099940..21143181 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtagtggtgggagctggtggtgttgggaagagtgctttgacg atacagctcattcagaaccatttcgttgacgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcatcgatggagagacttgcttgttagacatcttggatactgcaggg caagaggagtacagtgctatgagagaccagtacatgagaacgggggaaggattcctctgc gtctttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagctcggacagtggagacccggcaagcgcaggacctcgcccggagttacgggatcccc tacatagaaacgtctgccaaaaccagacagggtgttgaagatgccttctacaccttggta cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagtggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system