Ciconia boyciana (Oriental stork): 140656445 Help Entry 140656445         CDS       T10948                                  Name (RefSeq) C-C motif chemokine 3-like   KO K21083   C-C motif chemokine 17 Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04060   Cytokine-cytokine receptor interaction cboy04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:cboy00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     140656445  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     140656445  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cboy04052]     140656445 Cytokines and neuropeptides [BR:cboy04052]  Cytokines   Chemokines    140656445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  140656445 NCBI-ProteinID:  XP_072728247 LinkDB All DBs Position 9:23420536..23421955 Genome browser AA seq 87 aa AA seqDB search MLTARTGLLLVLLLTFFLHRATAHFTPTECCFKYAQKPIRHMQSFYETPSGCSLPAVVIV AATGAEVCADPKKPWVKRAMKTLRRKK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgctcactgcaaggacaggcctgctgctcgtgcttctcctcaccttcttcctgcaccgt gccacagcccacttcacgcccactgaatgctgcttcaagtatgcacagaagcccatccga cacatgcagagtttctatgagacgcccagcggctgctccttgcctgcagttgtgattgtg gctgccaccggtgccgaggtctgtgccgaccccaagaagccctgggtgaagagagccatg aaaacacttcgaaggaaaaaatga

DBGET integrated database retrieval system