Ciconia boyciana (Oriental stork): 140658286 Help Entry 140658286         CDS       T10948                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04081   Hormone signaling cboy04144   Endocytosis cboy04150   mTOR signaling pathway cboy04270   Vascular smooth muscle contraction cboy04310   Wnt signaling pathway cboy04350   TGF-beta signaling pathway cboy04510   Focal adhesion cboy04517   IgSF CAM signaling cboy04519   Cadherin signaling cboy04520   Adherens junction cboy04530   Tight junction cboy04621   NOD-like receptor signaling pathway cboy04625   C-type lectin receptor signaling pathway cboy04810   Regulation of actin cytoskeleton cboy05100   Bacterial invasion of epithelial cells cboy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cboy00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     140658286 (RHOA)    04350 TGF-beta signaling pathway     140658286 (RHOA)    04150 mTOR signaling pathway     140658286 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     140658286 (RHOA)    04517 IgSF CAM signaling     140658286 (RHOA)    04519 Cadherin signaling     140658286 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     140658286 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     140658286 (RHOA)    04520 Adherens junction     140658286 (RHOA)    04530 Tight junction     140658286 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     140658286 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     140658286 (RHOA)    04625 C-type lectin receptor signaling pathway     140658286 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     140658286 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     140658286 (RHOA)    05100 Bacterial invasion of epithelial cells     140658286 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cboy04131]     140658286 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cboy04147]     140658286 (RHOA)    04031 GTP-binding proteins [BR:cboy04031]     140658286 (RHOA) Membrane trafficking [BR:cboy04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     140658286 (RHOA) Exosome [BR:cboy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    140658286 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    140658286 (RHOA)   Exosomal proteins of colorectal cancer cells    140658286 (RHOA)   Exosomal proteins of bladder cancer cells    140658286 (RHOA) GTP-binding proteins [BR:cboy04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     140658286 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  140658286 NCBI-ProteinID:  XP_072732588 LinkDB All DBs Position 11:7826776..7854049 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggaacctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system