Ciconia boyciana (Oriental stork): 140658293 Help Entry 140658293         CDS       T10948                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy04810   Regulation of actin cytoskeleton cboy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cboy00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     140658293 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     140658293 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind LXG Motif Other DBs NCBI-GeneID:  140658293 NCBI-ProteinID:  XP_072732603 LinkDB All DBs Position 11:7973705..7974255 Genome browser AA seq 75 aa AA seqDB search MSVQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgcaggaggacccggtgcagcgggagatccaccaggactgggccaaccgcgag tacatcgaggtgatcaccagctccatcaagaagattgcggacttcctcaactccttcgac atgtcgtgccggtcccggctggccaccctgaacgagaagctgacggcgctcgagcgcagg atcgagtacatcgaggcccgggtcaccaagggcgagacgctgacgtag

DBGET integrated database retrieval system