Ciconia boyciana (Oriental stork): 809237 Help Entry 809237            CDS       T10948                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy00190   Oxidative phosphorylation cboy01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:cboy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     809237 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cboy03029]     809237 (ND4L) Enzymes [BR:cboy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      809237 (ND4L) Mitochondrial biogenesis [BR:cboy03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     809237 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  809237 NCBI-ProteinID:  NP_054666 UniProt:  Q9MR63 LinkDB All DBs Position MT:12027..12323 Genome browser AA seq 98 aa AA seqDB search MSLIHLGFYSAFTLSCLGLAFHRTHLISALLCLESMMLSLYLALSIWPIENQAASFTLMP VLMLTFSACEAGTGLAMLVASTRTHGSDHLHNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctctcatccacctaggcttctattcagccttcaccctaagctgcttaggactagcc ttccaccgaacccacctaatctccgccctactatgcttagaaagcataatactatccctg tacctcgccctatcaatctggcccatcgaaaaccaagcagcatcctttaccctaatacca gtacttatactcacattctcagcctgcgaagcaggcaccggcctagcaatactagtagcc tctacccgaacccatggctctgaccacctacacaacctaaaccttctacaatgctaa

DBGET integrated database retrieval system