Ciconia boyciana (Oriental stork): 809239 Help Entry 809239            CDS       T10948                                  Symbol ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism cboy  Ciconia boyciana (Oriental stork) Pathway cboy00190   Oxidative phosphorylation cboy01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:cboy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     809239 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cboy03029]     809239 (ND3) Enzymes [BR:cboy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      809239 (ND3) Mitochondrial biogenesis [BR:cboy03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     809239 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 Motif Other DBs NCBI-GeneID:  809239 NCBI-ProteinID:  NP_054665 UniProt:  Q7JDZ9 LinkDB All DBs Position MT:11602..11952 Genome browser AA seq 116 aa AA seqDB search MNTITFMLTLSLTLSIILTTLNFWLAQTNPDSEKLSPYECGFDPLGSARLPFSIRFFLVA ILFLLFDLEIALLLPIPWAIQLQSPITTLTWASTIILLLTLGLIYEWAQGGLEWAE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaacacaatcacatttatactcaccctctccctcaccctaagcatcatcctaaccaca ctaaacttctgactagcccaaacaaacccagactcagaaaaactatccccctacgaatgc ggctttgaccccctcggctccgcccgcctcccattctcaatccgattcttcctagtagca atcctattccttcttttcgacctagaaatcgcactcctacttcccatcccctgagccatc caacttcaatcccccatcaccaccctaacctgagcctccactatcattctcctactaaca ctaggactaatctacgaatgggcacaaggaggcctagaatgagcagaataa

DBGET integrated database retrieval system