Lawsonella clevelandensis: AL705_07370 Help Entry AL705_07370       CDS       T04080                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cbq  Lawsonella clevelandensis Pathway cbq01100   Metabolic pathways cbq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL705_07370    00074 Mycolic acid biosynthesis     AL705_07370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL705_07370 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ALE19381 UniProt:  A0A0M4MYC8 LinkDB All DBs Position complement(1705719..1705976) Genome browser AA seq 85 aa AA seqDB search MAADERDIVAGLAEIIEEVTGIEQTEVTPDKKFVDDLDVDSLSMVEIAVQTEDKYGIEIP DERMKGMGTVRDVVDYIKRVTVGRS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctgctgatgaaagagacatcgttgctggccttgccgagatcatcgaggaagtcacc ggtattgaacagactgaggtaactccagacaaaaagtttgtggatgacctggacgtagat tccctgtcgatggtagaaattgctgttcagaccgaggacaagtacggcattgaaattccc gatgagcgaatgaaaggtatgggcacggtacgcgatgtcgtcgattacattaaacgagtc actgtggggcgatcctga

DBGET integrated database retrieval system