Caenorhabditis briggsae (nematode): CBG_00481 Help Entry CBG_00481         CDS       T01054                                  Name (RefSeq) Protein CBG00481   KO K03094   S-phase kinase-associated protein 1 Organism cbr  Caenorhabditis briggsae (nematode) Pathway cbr03083   Polycomb repressive complex cbr04120   Ubiquitin mediated proteolysis cbr04141   Protein processing in endoplasmic reticulum cbr04310   Wnt signaling pathway cbr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:cbr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CBG_00481    04120 Ubiquitin mediated proteolysis     CBG_00481   09126 Chromosome    03083 Polycomb repressive complex     CBG_00481  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     CBG_00481    04350 TGF-beta signaling pathway     CBG_00481  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbr04131]     CBG_00481    04121 Ubiquitin system [BR:cbr04121]     CBG_00481    03036 Chromosome and associated proteins [BR:cbr03036]     CBG_00481 Membrane trafficking [BR:cbr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     CBG_00481 Ubiquitin system [BR:cbr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      CBG_00481    Cul7 complex      CBG_00481 Chromosome and associated proteins [BR:cbr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      CBG_00481   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      CBG_00481 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Motif Other DBs NCBI-GeneID:  8582914 NCBI-ProteinID:  XP_045091531 WormBase:  CBG00481 LinkDB All DBs Position III:complement(1762361..1762829) Genome browser AA seq 126 aa AA seqDB search MADAPAPPPESPTTLNNLVTGQGLDAEKAAKSSIPINNIDGATLEKNGMEFLKALKDEDL GKLVLAANYLETKKLLRYCCKKMAMMAQGKAPLELRILFEISTDEEDEHAEMGLKERHRV APSRKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggctgatgctccagccccaccaccagagagccccaccaccctcaacaatctggtcacc ggacaaggtctggatgcagagaaagcagccaaatcctcgattccaatcaataacatcgat ggagcgacactggagaagaatgggatggagttcttgaaggcgttgaaagatgaggatctc gggaaattggtgttggctgccaactacttggagacgaagaagcttcttcggtattgctgt aagaagatggcgatgatggctcagggaaaggctccactggagttgagaatccttttcgag atttcaactgatgaggaggatgagcatgctgagatgggattgaaggagagacaccgcgta gctccgtcgaggaaaaagtga

DBGET integrated database retrieval system