Caenorhabditis briggsae (nematode): CBG_06231 Help Entry CBG_06231         CDS       T01054                                  Symbol Cbr-dlc-2 Name (RefSeq) Protein CBR-DLC-2   KO K10418   dynein light chain LC8-type Organism cbr  Caenorhabditis briggsae (nematode) Pathway cbr04517   IgSF CAM signaling cbr04814   Motor proteins Brite KEGG Orthology (KO) [BR:cbr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CBG_06231 (Cbr-dlc-2)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     CBG_06231 (Cbr-dlc-2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cbr03037]     CBG_06231 (Cbr-dlc-2)    04812 Cytoskeleton proteins [BR:cbr04812]     CBG_06231 (Cbr-dlc-2) Cilium and associated proteins [BR:cbr03037]  Motile cilia and associated proteins   Dynein arm    CBG_06231 (Cbr-dlc-2) Cytoskeleton proteins [BR:cbr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CBG_06231 (Cbr-dlc-2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light GRXCR1-2_C Motif Other DBs NCBI-GeneID:  8575460 NCBI-ProteinID:  XP_002633463 WormBase:  CBG06231 UniProt:  A0AAE9JGI8 A8X0L0 LinkDB All DBs Position IV:complement(<9120798..>9121113) Genome browser AA seq 90 aa AA seqDB search MSEEKIEVKETDMEDSQRDMVISIVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGK CFGSRVSYEMGHFILLKCNKVNVMIYKCGY NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcggaagaaaaaatcgaagtaaaagagactgatatggaggattcccaacgagatatg gttatctcaattgttcgagaagctcagcgtctttataatattgataaggatgtggctgcg ttcgtcaaagaagagctcgataagaagtttggtgccacgtggcatgtcatctgtggaaag tgtttcggaagtcgtgttagctacgaaatgggacactttattcttctcaaatgcaacaag gtgaatgtgatgatctacaagtgcggatattaa

DBGET integrated database retrieval system