Caenorhabditis briggsae (nematode): CBG_09601 Help Entry CBG_09601         CDS       T01054                                  Symbol Cbr-crp-1 Name (RefSeq) Protein CBR-CRP-1   KO K04393   cell division control protein 42 Organism cbr  Caenorhabditis briggsae (nematode) Pathway cbr04144   Endocytosis cbr04517   IgSF CAM signaling cbr04518   Integrin signaling cbr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cbr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CBG_09601 (Cbr-crp-1)    04518 Integrin signaling     CBG_09601 (Cbr-crp-1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     CBG_09601 (Cbr-crp-1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CBG_09601 (Cbr-crp-1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbr04131]     CBG_09601 (Cbr-crp-1)    03036 Chromosome and associated proteins [BR:cbr03036]     CBG_09601 (Cbr-crp-1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbr04147]     CBG_09601 (Cbr-crp-1)    04031 GTP-binding proteins [BR:cbr04031]     CBG_09601 (Cbr-crp-1) Membrane trafficking [BR:cbr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CBG_09601 (Cbr-crp-1)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     CBG_09601 (Cbr-crp-1)   Macropinocytosis    Ras GTPases     CBG_09601 (Cbr-crp-1) Chromosome and associated proteins [BR:cbr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     CBG_09601 (Cbr-crp-1) Exosome [BR:cbr04147]  Exosomal proteins   Exosomal proteins of microglial cells    CBG_09601 (Cbr-crp-1)   Exosomal proteins of breast milk    CBG_09601 (Cbr-crp-1) GTP-binding proteins [BR:cbr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CBG_09601 (Cbr-crp-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU PduV-EutP MMR_HSR1 AAA_24 SRPRB FeoB_N Motif Other DBs NCBI-GeneID:  8579098 NCBI-ProteinID:  XP_002637102 WormBase:  CBG09601 UniProt:  A8X8P6 A0AAE9A0S6 LinkDB All DBs Position V:<10634784..>10636569 Genome browser AA seq 187 aa AA seqDB search MENKLKLVVVGDTFTGKTSLLVAYTKKQFLDNYSTTVFDNWAVSVHIDHKSYAVSLFDTA GQGSYEKIRCLSYPHTNIFLVCFSMTDKNTLESCRTIWIPEIRKYAGDNVPIMLVGTKND LVEGAHLHSVVTEDYAKKVAQEIGCHKFFSCSALTHKGLKRVFDESFLAAVGVKFEEEKP NPCCIIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggagaacaaactgaaattggttgtcgtgggggatacgttcactggtaaaactagcctt cttgtcgcctacacgaagaaacaatttctcgacaactattcgactacggtattcgacaat tgggcggtttcggtgcacattgatcacaaaagttatgcggtcagcttgtttgatactgct ggtcagggaagttacgaaaagattcgatgtctgagctatccacacacaaatatttttctt gtatgcttttcaatgaccgataagaatacattggagtcatgcagaactatttggatacca gaaatcagaaaatatgccggtgataatgtcccgatcatgcttgttggaacgaaaaatgat cttgtggagggtgcacatttacatagtgtcgtcacagaagattatgctaaaaaggtggca caagagataggatgtcacaaatttttttcgtgctccgccctcacccacaaaggcttgaag cgtgtatttgatgaaagctttctggcggctgtaggcgtcaaatttgaagaggagaagccg aatccgtgttgtataatactttaa

DBGET integrated database retrieval system