Caenorhabditis briggsae (nematode): CBG_16816 Help Entry CBG_16816         CDS       T01054                                  Name (RefSeq) Protein CBG16816   KO K09481   protein transport protein SEC61 subunit beta Organism cbr  Caenorhabditis briggsae (nematode) Pathway cbr03060   Protein export cbr04141   Protein processing in endoplasmic reticulum cbr04145   Phagosome Brite KEGG Orthology (KO) [BR:cbr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CBG_16816    04141 Protein processing in endoplasmic reticulum     CBG_16816  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CBG_16816  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbr04131]     CBG_16816   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cbr02044]     CBG_16816 Membrane trafficking [BR:cbr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     CBG_16816 Secretion system [BR:cbr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    CBG_16816 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  8587120 NCBI-ProteinID:  XP_002645122 WormBase:  CBG16816 UniProt:  A0AAE9AJH3 A8XPV4 LinkDB All DBs Position IV:16527240..16527549 Genome browser AA seq 80 aa AA seqDB search MADTGRSPRPTAGGVRQRKGGATAAPARARGGNNGGLWRFYTEDSTGLKIGPVPVLVMSL VFIASVFVLHIWGKFTRSRA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccgatactggacgcagcccacgaccaaccgccggaggagttcgtcagcgcaaagga ggagccaccgctgcgccggctcgtgctcgcggaggaaacaacggaggattgtggcgtttc tacaccgaagactccaccggactcaagatcggaccagttccagtgctcgtcatgtcgctc gtcttcatcgcctccgtttttgtccttcacatctggggaaaattcaccagaagccgtgct taa

DBGET integrated database retrieval system