Caenorhabditis briggsae (nematode): CBG_19681 Help Entry CBG_19681         CDS       T01054                                  Name (RefSeq) Protein CBG19681   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism cbr  Caenorhabditis briggsae (nematode) Pathway cbr03030   DNA replication cbr03082   ATP-dependent chromatin remodeling cbr03410   Base excision repair cbr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cbr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     CBG_19681    03410 Base excision repair     CBG_19681    03420 Nucleotide excision repair     CBG_19681   09126 Chromosome    03082 ATP-dependent chromatin remodeling     CBG_19681  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cbr03032]     CBG_19681    03036 Chromosome and associated proteins [BR:cbr03036]     CBG_19681    03400 DNA repair and recombination proteins [BR:cbr03400]     CBG_19681 Enzymes [BR:cbr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      CBG_19681 DNA replication proteins [BR:cbr03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     CBG_19681 Chromosome and associated proteins [BR:cbr03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     CBG_19681 DNA repair and recombination proteins [BR:cbr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       CBG_19681 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF DUF1778 Histone Motif Other DBs NCBI-GeneID:  8576688 NCBI-ProteinID:  XP_002634695 WormBase:  CBG19681 UniProt:  A8XW66 A0AAE9INZ3 LinkDB All DBs Position III:3747632..3748103 Genome browser AA seq 142 aa AA seqDB search MSRAAMEEVDERVAGMLLPAAIVTRLMKEENISGSKEARDLITRAAAVFLINLSDVAVQA AREVKQKTLSAEHVLKGLRDLEHNSIYNHCKQINDNWKVLRQQKLLQRKMADQQQTAEVE MEDEVVEEDDIVEDTPADDSMI NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgtccagagccgcaatggaggaagtagatgagcgggttgctgggatgctcctcccagct gccatcgtcactcgtctcatgaaagaagaaaatatttctggatcaaaagaagctcgcgat ctcatcactcgcgctgcagcagtttttcttataaacttgtcagacgtcgcagtgcaagct gctcgcgaagtgaaacagaagacgttgtctgctgagcatgtgctgaaggggctccgagat ctcgaacataattccatttacaatcattgcaagcaaatcaacgacaattggaaagtgctt cgccaacaaaaactgcttcaaagaaagatggccgatcagcagcagactgctgaagtcgaa atggaagatgaagtcgtcgaagaggatgacatcgtcgaagatacacctgctgatgattcg atgatctga

DBGET integrated database retrieval system