Caenorhabditis briggsae (nematode): CBG_19682 Help Entry CBG_19682         CDS       T01054                                  Symbol Cbr-dlc-1 Name (RefSeq) Protein CBR-DLC-1   KO K10418   dynein light chain LC8-type Organism cbr  Caenorhabditis briggsae (nematode) Pathway cbr04517   IgSF CAM signaling cbr04814   Motor proteins Brite KEGG Orthology (KO) [BR:cbr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CBG_19682 (Cbr-dlc-1)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     CBG_19682 (Cbr-dlc-1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cbr03037]     CBG_19682 (Cbr-dlc-1)    04812 Cytoskeleton proteins [BR:cbr04812]     CBG_19682 (Cbr-dlc-1) Cilium and associated proteins [BR:cbr03037]  Motile cilia and associated proteins   Dynein arm    CBG_19682 (Cbr-dlc-1) Cytoskeleton proteins [BR:cbr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CBG_19682 (Cbr-dlc-1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  8576689 NCBI-ProteinID:  XP_002634696 WormBase:  CBG19682 UniProt:  A0AAE9IMS8 A8XW67 LinkDB All DBs Position III:<3746694..>3747242 Genome browser AA seq 89 aa AA seqDB search MVDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggttgaccgcaaggctgtgatcaagaacgccgacatgtccgatgacatgcaacaggac gccatcgactgcgccacccaggctctcgagaagtacaacatcgagaaggatatcgctgct tacatcaagaaggagttcgacaagaagtacaacccaacctggcactgcatcgtcggaaga aacttcggaagctacgtgactcacgagacgaaacacttcatctacttctatctcggacag gtcgctattctgctcttcaagtccggataa

DBGET integrated database retrieval system