Corvus brachyrhynchos (American crow): 103614310 Help Entry 103614310         CDS       T08418                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04137   Mitophagy - animal cbrc04140   Autophagy - animal cbrc04144   Endocytosis cbrc04145   Phagosome cbrc04148   Efferocytosis cbrc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbrc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103614310 (RAB7A)    04145 Phagosome     103614310 (RAB7A)    04140 Autophagy - animal     103614310 (RAB7A)    04137 Mitophagy - animal     103614310 (RAB7A)    04148 Efferocytosis     103614310 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103614310 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbrc04131]     103614310 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbrc04147]     103614310 (RAB7A)    04031 GTP-binding proteins [BR:cbrc04031]     103614310 (RAB7A) Membrane trafficking [BR:cbrc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103614310 (RAB7A) Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103614310 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    103614310 (RAB7A)   Exosomal proteins of colorectal cancer cells    103614310 (RAB7A)   Exosomal proteins of bladder cancer cells    103614310 (RAB7A) GTP-binding proteins [BR:cbrc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103614310 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC FLYWCH_N ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  103614310 NCBI-ProteinID:  XP_008630451 UniProt:  A0A091ENX0 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKTDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcactcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacggtttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgtttgatgtcacggcccccaacacattcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aacgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccctgaacccatcaaactagacaagactgaccgagcgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system